DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment Cht10 and chia.5

DIOPT Version :9

Sequence 1:NP_001036422.1 Gene:Cht10 / 3355116 FlyBaseID:FBgn0250907 Length:2286 Species:Drosophila melanogaster
Sequence 2:NP_001103511.2 Gene:chia.5 / 100003900 ZFINID:ZDB-GENE-071004-113 Length:481 Species:Danio rerio


Alignment Length:496 Identity:174/496 - (35%)
Similarity:256/496 - (51%) Gaps:82/496 - (16%)


- Green bases have known domain annotations that are detailed below.


  Fly   966 KVICYFTNWAWYRKGIGRFTPDDINTELCTHVIYGFAVLDYSELVLRTHDSWADVENNFYTRVTS 1030
            ::|||||||:.||..:|::.|.:::..||||:||.|:::: :|..|.|:: |.|  ...|.....
Zfish    22 QLICYFTNWSQYRPDVGKYMPSNVDPHLCTHLIYAFSIIN-NENKLTTYE-WND--ETLYQSFNG 82

  Fly  1031 LK--SKGIKVSLALGGWNDSQGDKYSRLVRSPMARSRFVRHALEFIEKYGFEGLDLDWEYPVCWQ 1093
            ||  :..:|..||:|||..... ::|.:|..|..|..|::.::.|:..:||:|||||||||    
Zfish    83 LKQSNSNLKTLLAVGGWEFGSA-QFSSMVSMPQNRQTFIQSSITFLRTHGFDGLDLDWEYP---- 142

  Fly  1094 TECNKGS-TEEKDGFTAWVQELSEAF--------RPRGLMLSTAVSPSRKIIDAGYDIPQLSRYF 1149
              .::|| .|:|..||...:||.||:        ||| |||:.||:..:.||||||:|.::::|.
Zfish   143 --GSRGSPPEDKQRFTLLCKELVEAYQAESAATGRPR-LMLTAAVAAVKGIIDAGYEIAEIAKYL 204

  Fly  1150 DWIAVMTYDFHGHWDKKTGHVAPLYHHPDD--DFEYFNVNYSINYWMEKGAPSQKLVMGIPLYGQ 1212
            |:|.:|||||||..|..|||.:|||....|  |..|:|.::::|||.::|||.:||.||...||:
Zfish   205 DFINIMTYDFHGSQDNITGHNSPLYRDSGDTGDQIYYNTDFAMNYWRDQGAPVEKLRMGFAAYGR 269

  Fly  1213 SFTLENTNSSGLNAKAPAPGEAGEFTRAAGFLAYYEICERVNRQGWQVVHDEFGRMGPYAYKGTQ 1277
            :|.|.:.: :|:.|.|.....||.:||.|||.:|||||..:  || .:|.....:..|||.||.:
Zfish   270 TFRLSSAD-NGVGAPASGAALAGTYTREAGFWSYYEICTFL--QG-AIVQQIVDQKVPYATKGQE 330

  Fly  1278 WVSYDSPDMVRKKSLLVRSLKLGGGMVWALDLDDFKNR-CGNGVHPLLTEIHNVLK----DPPSL 1337
            ||.:|..:....|...::....||..||:||||||..: ||.|.:||:..:|.:|.    |.|||
Zfish   331 WVGFDDQESYETKVDYLKEKGFGGAFVWSLDLDDFSGQFCGQGKYPLIGHLHTLLNISNTDFPSL 395

  Fly  1338 ---------------------MEIPGPIETTPTEYPGMEEEIHESNGEGPEVQPIEAVMQTCENE 1381
                                 ..||..:.|.|:     ..:...|..||....|           
Zfish   396 PPSTTDKASGTSTTASAAVPHTTIPPVVPTAPS-----GSDFCASRSEGIYANP----------- 444

  Fly  1382 GEEHEGILDPNHVLEEEN----IEATEMATEFKIICYFTNW 1418
                   .||...::..|    |:.....|.|...|...||
Zfish   445 -------ADPKTFIQCANGRTFIQNCPATTVFDPDCTCCNW 478

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
Cht10NP_001036422.1 Glyco_18 220..565 CDD:214753
GH18_chitolectin_chitotriosidase 221..586 CDD:119351
ChtBD2 697..737 CDD:214696
CBM_14 801..848 CDD:279884
CBM_14 875..918 CDD:279884
Glyco_18 966..1310 CDD:214753 142/356 (40%)
GH18_chitolectin_chitotriosidase 967..1331 CDD:119351 152/377 (40%)
Glyco_18 1410..1753 CDD:214753 3/9 (33%)
GH18_chitolectin_chitotriosidase 1411..1774 CDD:119351 3/8 (38%)
ChtBD2 1834..1871 CDD:214696
Glyco_18 1909..2253 CDD:214753
GH18_chitolectin_chitotriosidase 1910..2274 CDD:119351
chia.5NP_001103511.2 Glyco_18 22..363 CDD:214753 142/356 (40%)
GH18_chitolectin_chitotriosidase 23..381 CDD:119351 151/373 (40%)
CBM_14 433..479 CDD:279884 13/64 (20%)
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 1 0.900 - - E1_COG3325
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 1 1.010 - - D264489at33208
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 00.000 Not matched by this tool.
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
ZFIN 00.000 Not matched by this tool.
21.910

Return to query results.
Submit another query.