DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment Spf45 and GDS1

DIOPT Version :9

Sequence 1:NP_001036426.1 Gene:Spf45 / 3355114 FlyBaseID:FBgn0086683 Length:403 Species:Drosophila melanogaster
Sequence 2:NP_015000.3 Gene:GDS1 / 854537 SGDID:S000005882 Length:522 Species:Saccharomyces cerevisiae


Alignment Length:275 Identity:57/275 - (20%)
Similarity:93/275 - (33%) Gaps:94/275 - (34%)


- Green bases have known domain annotations that are detailed below.


  Fly    97 PQRPNEYEKL-------KEKSNGSDKNRAGVSDREDRDD--KEKDRKRGRVGRREFYRDEVSAP- 151
            |...|..::|       |.|:|...:|.......|...:  |.|..|.|:..:.:.. ..:|.| 
Yeast   302 PSMSNNQQQLLTPNSASKSKNNNKKRNYMDEDTNESMTEPKKTKTTKPGKQTKSQSL-SVLSTPK 365

  Fly   152 ---NLKLSGFGHRQNDDDMYLPSPGLVAKQGGATIAPPPSLQEMSIDSGCEATNTMPYSASSVAA 213
               :..||.|...:|                   |:|..||...:      ::||  |..::.||
Yeast   366 KGSSASLSTFASSKN-------------------ISPDSSLSHNA------SSNT--YVTAAAAA 403

  Fly   214 ----KIMAKYGFKDGQGLGKSEQGMAIALQVEKTSKRGGRI--IHEKDVFLPPLALSPPSIGSQI 272
                |::.|.|||                   |.|:....:  ||:......|:..|..|  ||.
Yeast   404 PRLSKLLPKNGFK-------------------KNSRSSSELAAIHKVISTQTPIESSSES--SQY 447

  Fly   273 GTSPSHKAMPPPQMVDTAAESGDIGYSITEIMKSPSKVVLLRNMVGPGDVDEELEPEVKDECN-- 335
            .:|.|       ..|::||.|.  ..|:::|..|.             |...|..|..::..|  
Yeast   448 NSSSS-------SPVNSAAASS--AESLSDINSSQ-------------DNGRESNPSSQESRNEV 490

  Fly   336 TKYGEV--NSVIIHE 348
            |.:.::  |..:.|:
Yeast   491 TNWMKIVRNGFLTHD 505

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
Spf45NP_001036426.1 G-patch 209..248 CDD:279867 9/42 (21%)
RRM_UHM_SPF45 307..402 CDD:241091 7/46 (15%)
GDS1NP_015000.3 None


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 1 0.950 - 0.78878 Normalized mean entropy S3904
OMA 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 00.000 Not matched by this tool.
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
10.950

Return to query results.
Submit another query.