DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment Spf45 and SLA1

DIOPT Version :9

Sequence 1:NP_001036426.1 Gene:Spf45 / 3355114 FlyBaseID:FBgn0086683 Length:403 Species:Drosophila melanogaster
Sequence 2:NP_009546.1 Gene:SLA1 / 852276 SGDID:S000000103 Length:1244 Species:Saccharomyces cerevisiae


Alignment Length:305 Identity:57/305 - (18%)
Similarity:94/305 - (30%) Gaps:110/305 - (36%)


- Green bases have known domain annotations that are detailed below.


  Fly   104 EKLK----EKSNGSDKNRAGVSDRE------DRDDKEKDRKRGRVGRREFYR------------- 145
            ||.|    ..|.|:|...   |:||      ::::||:||   |:..||.|.             
Yeast   555 EKFKANDGSSSRGTDSRD---SERERRRRLKEQEEKERDR---RLKERELYELKKARELLDEERS 613

  Fly   146 --DEVSAPNLKLSGFGHRQNDDDMYLPSPGLVAKQGGATIAPPPSLQ------------EMSIDS 196
              .|...|.:|              .|.|.........|..||....            |..::.
Yeast   614 RLQEKELPPIK--------------PPRPTSTTSVPNTTSVPPAESSNNNNSSNKYDWFEFFLNC 664

  Fly   197 GCEATNTMPYSAS------------SVAAKIMAKYGFKDGQGLGKSEQGMAIALQVEKTSKRGGR 249
            |.:.:|...|:.:            .:...::...|.::|.          |...::...|:.||
Yeast   665 GVDVSNCQRYTINFDREQLTEDMMPDINNSMLRTLGLREGD----------IVRVMKHLDKKFGR 719

  Fly   250 IIHEKDVFLPPLA----LSPPSIGSQIGTSPS----HKAMP----PPQMVDTAAESGDIGYSITE 302
               |....:|..|    .|.|.....:.|||.    .:.:|    |.|...:.:...|..:::..
Yeast   720 ---ENIASIPTNATGNMFSQPDGSLNVATSPETSLPQQLLPQTTSPAQTAPSTSAETDDAWTVKP 781

  Fly   303 IMKSPSKVVLLRNMVGPGDVDEEL---------------EPEVKD 332
            ..||.|. :|.:.....|.:.:.|               ||.:||
Yeast   782 ASKSESN-LLSKKSEFTGSMQDLLDLQPLEPKKAAASTPEPNLKD 825

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
Spf45NP_001036426.1 G-patch 209..248 CDD:279867 4/50 (8%)
RRM_UHM_SPF45 307..402 CDD:241091 8/41 (20%)
SLA1NP_009546.1 SH3_Sla1p_1 7..64 CDD:212707
SH3 73..127 CDD:327375
SH3_Sla1p_3 356..412 CDD:212709
SHD1 489..554 CDD:309199
SAM_SLA1_fungal 655..716 CDD:188931 7/70 (10%)
MotB_plug <738..848 CDD:330912 17/89 (19%)
Med15 831..>1201 CDD:312941
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 1 0.950 - 0.78878 Normalized mean entropy S3904
OMA 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 00.000 Not matched by this tool.
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
10.950

Return to query results.
Submit another query.