DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment Spf45 and SCN10A

DIOPT Version :9

Sequence 1:NP_001036426.1 Gene:Spf45 / 3355114 FlyBaseID:FBgn0086683 Length:403 Species:Drosophila melanogaster
Sequence 2:XP_005265428.1 Gene:SCN10A / 6336 HGNCID:10582 Length:1959 Species:Homo sapiens


Alignment Length:221 Identity:46/221 - (20%)
Similarity:70/221 - (31%) Gaps:75/221 - (33%)


- Green bases have known domain annotations that are detailed below.


  Fly   143 FYRDEVSAP-------NL-----KLSGFGHRQNDDDMYLPSPGLVAKQGGATIAPPPSLQEMSID 195
            |..|.::||       ||     ::..||||...        .|.:....:...|.|..:.    
Human   896 FSADNLTAPEDDGEVNNLQVALARIQVFGHRTKQ--------ALCSFFSRSCPFPQPKAEP---- 948

  Fly   196 SGCEATNTMPYSASSVAAKIMAKYGFKDGQGLGKSEQGMAIALQVEKTSKRGGRIIHEKDVFLPP 260
               |....:|.|:|.....|.|           .:.:|.:..||    :.||.|..|...:..|.
Human   949 ---ELVVKLPLSSSKAENHIAA-----------NTARGSSGGLQ----APRGPRDEHSDFIANPT 995

  Fly   261 LALSPP------------SIGSQIGTSPSHKAMPPPQ--MVDTAAESGDIGYSITEIMKSPSKVV 311
            :.:|.|            ..|.:...|...:.:|..|  .:......||   .:|.  :||    
Human   996 VWVSVPIAEGESDLDDLEDDGGEDAQSFQQEVIPKGQQEQLQQVERCGD---HLTP--RSP---- 1051

  Fly   312 LLRNMVGPGDVDEELEPEV----KDE 333
                  |.|...|:|.|.:    |||
Human  1052 ------GTGTSSEDLAPSLGETWKDE 1071

Known Domains:


Indicated by green bases in alignment.

Software error:

Illegal division by zero at /www/www.flyrnai.org/docroot/cgi-bin/DRSC_prot_align.pl line 591.

For help, please send mail to the webmaster (ritg@hms.harvard.edu), giving this error message and the time and date of the error.

GeneSequenceDomainRegion External IDIdentity
Spf45NP_001036426.1 G-patch 209..248 CDD:279867 7/38 (18%)
RRM_UHM_SPF45 307..402 CDD:241091 9/31 (29%)
SCN10AXP_005265428.1 Ion_trans 150..410 CDD:278921
Na_trans_cytopl 466..>537 CDD:288761