DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment Spf45 and PTGS2

DIOPT Version :9

Sequence 1:NP_001036426.1 Gene:Spf45 / 3355114 FlyBaseID:FBgn0086683 Length:403 Species:Drosophila melanogaster
Sequence 2:NP_000954.1 Gene:PTGS2 / 5743 HGNCID:9605 Length:604 Species:Homo sapiens


Alignment Length:198 Identity:39/198 - (19%)
Similarity:66/198 - (33%) Gaps:76/198 - (38%)


- Green bases have known domain annotations that are detailed below.


  Fly   173 GLVAKQGGATIAPPPSLQEMSIDSGCEATNTMPYSA----------------------SSVAAKI 215
            |.||  ||..:  ||::|::| .:..:.:..|.|.:                      ..::|::
Human   418 GRVA--GGRNV--PPAVQKVS-QASIDQSRQMKYQSFNEYRKRFMLKPYESFEELTGEKEMSAEL 477

  Fly   216 MAKYGFKDGQGLGKSEQGMAIALQVEKTSKRGGRIIHEK---------------DVFLPPLALSP 265
            .|.||..|...|..       ||.|||  .|...|..|.               :|...|....|
Human   478 EALYGDIDAVELYP-------ALLVEK--PRPDAIFGETMVEVGAPFSLKGLMGNVICSPAYWKP 533

  Fly   266 PSIGSQIGTSPSHKA-------------------MPPPQMVDT------AAESGDIGYSITEIMK 305
            .:.|.::|....:.|                   :|.|:::.|      ::.||....:.|.::|
Human   534 STFGGEVGFQIINTASIQSLICNNVKGCPFTSFSVPDPELIKTVTINASSSRSGLDDINPTVLLK 598

  Fly   306 SPS 308
            ..|
Human   599 ERS 601

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
Spf45NP_001036426.1 G-patch 209..248 CDD:279867 12/38 (32%)
RRM_UHM_SPF45 307..402 CDD:241091 1/2 (50%)
PTGS2NP_000954.1 EGF_CA 19..54 CDD:238011
prostaglandin_endoperoxide_synthase 75..562 CDD:188648 31/157 (20%)
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 1 0.950 - 0.78878 Normalized mean entropy S3904
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 00.000 Not matched by this tool.
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
User_Submission 00.000 Not matched by this tool.
10.950

Return to query results.
Submit another query.