DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment Spf45 and SPAC2G11.04

DIOPT Version :9

Sequence 1:NP_001036426.1 Gene:Spf45 / 3355114 FlyBaseID:FBgn0086683 Length:403 Species:Drosophila melanogaster
Sequence 2:NP_593084.1 Gene:SPAC2G11.04 / 2541946 PomBaseID:SPAC2G11.04 Length:301 Species:Schizosaccharomyces pombe


Alignment Length:326 Identity:67/326 - (20%)
Similarity:106/326 - (32%) Gaps:132/326 - (40%)


- Green bases have known domain annotations that are detailed below.


  Fly     3 LYDGIDTRA------------------------------------RSSQIDGWSSGIKMLQTQLA 31
            ||:|||:::                                    ::|....:.:.::.|.:...
pombe     5 LYEGIDSKSIEEITEESEKTKTDLQKANTPNKTEAVHSLNNTCSEQNSGTKDYLNSLQFLPSNFR 69

  Fly    32 VKMAVKKPLMTPVVNLRSKRLAD---PEVTC----FAPITT------------VVSKPLISGKAL 77
            .|...||..::..::...::.|:   |.|.|    .:.:||            ..|||....|..
pombe    70 PKTHKKKKSVSSYLSSTIQKNANENIPHVQCRNDSQSTVTTRNPTPFKIEVGIYPSKPNNLNKEP 134

  Fly    78 P-SILERINRGD-----WDVADEYDPQRPNEYEKLKEKSNGSDKNRAGVSDREDRDDKEKDRKRG 136
            | |.:...|.||     |  .:.|||..|..|...||....                        
pombe   135 PASTVHSDNLGDAVEHEW--VELYDPLFPTSYSVFKESDYA------------------------ 173

  Fly   137 RVGRREFYRDEVSAPNLKLSGFGHRQNDDDMYLPSPGLVAKQGG------ATIAPPPSL------ 189
                           ||..:.:.|..|.    :||..:.||...      :.|.|||||      
pombe   174 ---------------NLCETNWSHYVNQ----VPSLSIEAKLSNIVNASKSGIGPPPSLLSHATL 219

  Fly   190 ----QEMSIDSGCEATN------TMPYSASS----VAAKIMAKYGFKDGQGLGKSEQGMAIALQV 240
                :.|.:.:...|.:      :.|..|.|    ||.|::.:.|:|:|||||:..||:...|.|
pombe   220 ARPSESMVLSNNIAAEDLDFFKKSPPVPAISKKENVALKMLQRCGWKEGQGLGQHNQGIINPLHV 284

  Fly   241 E 241
            |
pombe   285 E 285

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
Spf45NP_001036426.1 G-patch 209..248 CDD:279867 16/37 (43%)
RRM_UHM_SPF45 307..402 CDD:241091
SPAC2G11.04NP_593084.1 G-patch 253..288 CDD:279867 15/33 (45%)
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoFinder 1 1.000 - - FOG0005833
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 00.000 Not matched by this tool.
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
11.000

Return to query results.
Submit another query.