DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment Spf45 and hpx-2

DIOPT Version :9

Sequence 1:NP_001036426.1 Gene:Spf45 / 3355114 FlyBaseID:FBgn0086683 Length:403 Species:Drosophila melanogaster
Sequence 2:NP_506432.1 Gene:hpx-2 / 179880 WormBaseID:WBGene00008627 Length:718 Species:Caenorhabditis elegans


Alignment Length:188 Identity:41/188 - (21%)
Similarity:68/188 - (36%) Gaps:65/188 - (34%)


- Green bases have known domain annotations that are detailed below.


  Fly    48 RSKRLAD-----PEVTCFAPITTVVSKPLISGKALPSILERINRGDWDVADEYDPQR-------- 99
            ||||.|:     |.:.|.....|.:..  |:|..       .||.:.|:.:...|.|        
 Worm   133 RSKRQANRRCSSPPINCNNRFHTSIRS--ITGLC-------NNRQNSDLGNSVSPLRRILGAASY 188

  Fly   100 PNEYEKLKEKS-NGSDKNRAGVSDREDRDDKEKDRKRGRVGRREFYRDEVSAPNLK----LSG-- 157
            .:...:::.:| ||.:...|.:......||:               .::|.:|::.    :.|  
 Worm   189 ADGLGRIRTRSVNGGELPSARLISNRIHDDR---------------NNQVFSPSINHLHMIIGQF 238

  Fly   158 FGHRQNDDDMYLPSPGLVAKQGGATIAPPPSLQEMSIDSGCEATNTMPYSASSVAAKI 215
            ..|    |.:::||.  ||:.|||            :|  |.|.|: |...|...|.|
 Worm   239 IAH----DVVFMPSS--VARDGGA------------LD--CSACNS-PQRVSPNCAPI 275

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
Spf45NP_001036426.1 G-patch 209..248 CDD:279867 3/7 (43%)
RRM_UHM_SPF45 307..402 CDD:241091
hpx-2NP_506432.1 An_peroxidase 158..696 CDD:376988 33/163 (20%)
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 1 0.950 - 0.78878 Normalized mean entropy S3904
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 00.000 Not matched by this tool.
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
10.950

Return to query results.
Submit another query.