DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment Parp and Y75B7B.2

DIOPT Version :9

Sequence 1:NP_001104452.1 Gene:Parp / 3355109 FlyBaseID:FBgn0010247 Length:994 Species:Drosophila melanogaster
Sequence 2:NP_503400.1 Gene:Y75B7B.2 / 178622 WormBaseID:WBGene00022289 Length:204 Species:Caenorhabditis elegans


Alignment Length:195 Identity:38/195 - (19%)
Similarity:83/195 - (42%) Gaps:32/195 - (16%)


- Green bases have known domain annotations that are detailed below.


  Fly   633 QKLVKHESHFFTSKLEISVQNLIK------LIFDIDSMNKT----LMEFHIDMDKM------PLG 681
            |:.|:|::   |::.:.|.:|.||      |.::..:..:.    |:|.:::..|:      |.|
 Worm     3 QQRVQHQA---TARAKSSRKNGIKNGNHTLLCYETKTEEQNPLTKLIEDNVEYSKLCQLCKIPDG 64

  Fly   682 KLSAHQIQ----SAYRV-VKEIYNVLECG---SNTAKLIDATNRFYTLIPHNFGVQLPTLIETHQ 738
            .:|..|::    :|.|: .:|:.:.|..|   .:...|..||.....|......|.:......::
 Worm    65 PISESQLEFHLVTAVRMGHRELASALAQGPVRMHCNDLHRATLNDEKLAARILSVSVAKKAYMNK 129

  Fly   739 QIEDLR--QMLDSLAEIEVAYSIIKSEDVSDACNPLDNHYAQIKTQLVALD---KNSEEFSILSQ 798
            .|..|:  .:.:|:..:|...::..:.::.|..|....|||........::   ||....::|::
 Worm   130 NITPLQTAAISNSIHMLEAVRAVYPTINIPDQDNWYTMHYAACAPGTAPMEFLLKNGGSVTMLTK 194

  Fly   799  798
             Worm   195  194

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
ParpNP_001104452.1 PLN03123 6..992 CDD:215590 38/195 (19%)
zf-PARP 10..83 CDD:279039
zf-PARP 114..193 CDD:279039
PADR1 270..322 CDD:285325
BRCT 382..454 CDD:214602
WGR_PARP1_like 526..629 CDD:153428
parp_like 645..988 CDD:238717 34/183 (19%)
Y75B7B.2NP_503400.1 ANKYR <99..>204 CDD:223738 17/96 (18%)
ANK repeat 132..160 CDD:293786 3/27 (11%)
ANK repeat 162..193 CDD:293786 6/30 (20%)
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 1 0.900 - - E1_KOG1037
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 00.000 Not matched by this tool.
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
10.900

Return to query results.
Submit another query.