DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG41128 and AT1G72170

DIOPT Version :10

Sequence 1:NP_001015402.3 Gene:CG41128 / 3355108 FlyBaseID:FBgn0069923 Length:72 Species:Drosophila melanogaster
Sequence 2:NP_565036.1 Gene:AT1G72170 / 843548 AraportID:AT1G72170 Length:102 Species:Arabidopsis thaliana


Alignment Length:72 Identity:21/72 - (29%)
Similarity:35/72 - (48%) Gaps:6/72 - (8%)


- Green bases have known domain annotations that are detailed below.


  Fly     4 RDNIFEEKICN-RLDHCVSDVLIKGCGGVIIGSAVSFLILKRRAWPVW----LGAGFGMGIAYRT 63
            :|::..|...| :.|.|: |:.::......:|.|.:.|:..|.....|    ||||.|:|.||..
plant     5 KDSVPPEYDVNAKWDACL-DLTVRRFVYSSLGGAFAGLLFFRSPVTRWASIALGAGIGIGSAYSD 68

  Fly    64 CEKDLNS 70
            |.:..:|
plant    69 CSRAFDS 75

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG41128NP_001015402.3 DUF543 <17..69 CDD:461300 17/55 (31%)
AT1G72170NP_565036.1 DUF543 2..74 CDD:461300 20/69 (29%)

Return to query results.
Submit another query.