DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG41128 and Micos10

DIOPT Version :10

Sequence 1:NP_001015402.3 Gene:CG41128 / 3355108 FlyBaseID:FBgn0069923 Length:72 Species:Drosophila melanogaster
Sequence 2:NP_001156478.1 Gene:Micos10 / 433771 MGIID:1913628 Length:76 Species:Mus musculus


Alignment Length:62 Identity:21/62 - (33%)
Similarity:35/62 - (56%) Gaps:0/62 - (0%)


- Green bases have known domain annotations that are detailed below.


  Fly     9 EEKICNRLDHCVSDVLIKGCGGVIIGSAVSFLILKRRAWPVWLGAGFGMGIAYRTCEKDLNS 70
            |.::..:.|.|::|.::|...|..:|...|....|||.||:..|:|.|:|:||..|:.|..:
Mouse     3 ESELGRKWDRCMADTVVKLGTGFGLGIVFSLTFFKRRMWPLAFGSGVGLGMAYSNCQHDFQA 64

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG41128NP_001015402.3 DUF543 <17..69 CDD:461300 20/51 (39%)
Micos10NP_001156478.1 DUF543 1..62 CDD:461300 20/58 (34%)

Return to query results.
Submit another query.