DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG41128 and Micos10

DIOPT Version :10

Sequence 1:NP_001015402.3 Gene:CG41128 / 3355108 FlyBaseID:FBgn0069923 Length:72 Species:Drosophila melanogaster
Sequence 2:NP_001167027.1 Gene:Micos10 / 362641 RGDID:1560187 Length:76 Species:Rattus norvegicus


Alignment Length:54 Identity:21/54 - (38%)
Similarity:31/54 - (57%) Gaps:0/54 - (0%)


- Green bases have known domain annotations that are detailed below.


  Fly    17 DHCVSDVLIKGCGGVIIGSAVSFLILKRRAWPVWLGAGFGMGIAYRTCEKDLNS 70
            |.|::|.|:|...|..:|...|....|||.||:..|:|.|:|:||..|:.|..:
  Rat    11 DRCMADALVKLGTGFGLGMVFSLTFFKRRKWPLAFGSGVGLGMAYSNCQHDFQA 64

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG41128NP_001015402.3 DUF543 <17..69 CDD:461300 21/51 (41%)
Micos10NP_001167027.1 DUF543 1..62 CDD:461300 20/50 (40%)

Return to query results.
Submit another query.