DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment Tim17b and TIM17

DIOPT Version :9

Sequence 1:NP_001015401.1 Gene:Tim17b / 3355107 FlyBaseID:FBgn0263977 Length:173 Species:Drosophila melanogaster
Sequence 2:NP_012392.1 Gene:TIM17 / 853298 SGDID:S000003679 Length:158 Species:Saccharomyces cerevisiae


Alignment Length:145 Identity:78/145 - (53%)
Similarity:100/145 - (68%) Gaps:2/145 - (1%)


- Green bases have known domain annotations that are detailed below.


  Fly     3 EYAREPCPYRIVDDCGGAFAMGCIGGGVFQAIKGFRNAPSGLNRRLVGSIIAIKTRSPVIAGNFA 67
            :::|:|||..|::|.|||||||.|||.|:..||||||:|  |..|..|::.|||.|:||:.|||.
Yeast     4 DHSRDPCPIVILNDFGGAFAMGAIGGVVWHGIKGFRNSP--LGERGSGAMSAIKARAPVLGGNFG 66

  Fly    68 VWGGMFSTIDCTLVHFRKKEDPWNSIISGAATGGILAARNGVPAMAGSAIIGGVLLALIEGVGIL 132
            ||||:|||.||.:...||:|||||:||:|..|||.||.|.|......|:|....||.:|||||::
Yeast    67 VWGGLFSTFDCAVKAVRKREDPWNAIIAGFFTGGALAVRGGWRHTRNSSITCACLLGVIEGVGLM 131

  Fly   133 FTRISADQFKNPIPP 147
            |.|.:|.|.|...||
Yeast   132 FQRYAAWQAKPMAPP 146

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
Tim17bNP_001015401.1 Tim17 1..155 CDD:295283 78/145 (54%)
TIM17NP_012392.1 3a0801so1tim17 2..158 CDD:130053 78/145 (54%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 1 0.930 - - C157344796
Domainoid 1 1.000 120 1.000 Domainoid score I1257
eggNOG 1 0.900 - - E1_COG5596
Hieranoid 1 1.000 - -
Homologene 1 1.000 - - H4620
Inparanoid 1 1.050 155 1.000 Inparanoid score I1087
Isobase 1 0.950 - 0 Normalized mean entropy S575
OMA 1 1.010 - - QHG54844
OrthoFinder 1 1.000 - - FOG0001103
OrthoInspector 1 1.000 - - otm46543
orthoMCL 1 0.900 - - OOG6_101935
Panther 1 1.100 - - LDO PTHR10485
Phylome 1 0.910 - -
RoundUp 1 1.030 - avgDist Average_Evolutionary_Distance R2313
SonicParanoid 1 1.000 - - X753
TreeFam 1 0.960 - -
1615.740

Return to query results.
Submit another query.