DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment Tim17b and TIM17-1

DIOPT Version :9

Sequence 1:NP_001015401.1 Gene:Tim17b / 3355107 FlyBaseID:FBgn0263977 Length:173 Species:Drosophila melanogaster
Sequence 2:NP_173460.1 Gene:TIM17-1 / 838623 AraportID:AT1G20350 Length:218 Species:Arabidopsis thaliana


Alignment Length:157 Identity:80/157 - (50%)
Similarity:107/157 - (68%) Gaps:6/157 - (3%)


- Green bases have known domain annotations that are detailed below.


  Fly     3 EYAREPCPYRIVDDCGGAFAMGCIGGGVFQAIKGFRNAPSGLNRRLVGSIIAIKTRSPVIAGNFA 67
            |.:|||||.||:||.|||||||.:||..:..|:|..|:|.|  .||.|.:.|::...|...|:|:
plant     5 ESSREPCPDRILDDVGGAFAMGAVGGSAYHLIRGIYNSPGG--ARLSGGVQALRMSGPRSGGSFS 67

  Fly    68 VWGGMFSTIDCTLVHFRKKEDPWNSIISGAATGGILAARNGVPAMAGSAIIGGVLLALIEGVGIL 132
            ||||::||.||.||:.|:||||||||:|||||||.|:.|.|:.|.|.||::||||||:||||||:
plant    68 VWGGLYSTFDCALVYARQKEDPWNSILSGAATGGFLSLRQGLGASARSALVGGVLLAMIEGVGIM 132

  Fly   133 FTRISA----DQFKNPIPPAEDPVALG 155
            ..::.:    :||.........|..:|
plant   133 LNKVQSTAHNEQFMEDHAATSLPYGMG 159

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
Tim17bNP_001015401.1 Tim17 1..155 CDD:295283 79/155 (51%)
TIM17-1NP_173460.1 Tim17 7..148 CDD:413300 77/142 (54%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Domainoid 1 1.000 130 1.000 Domainoid score I1702
eggNOG 1 0.900 - - E1_COG5596
Hieranoid 1 1.000 - -
Homologene 1 1.000 - - H4620
Inparanoid 1 1.050 168 1.000 Inparanoid score I1558
OMA 00.000 Not matched by this tool.
OrthoDB 1 1.010 - - D1590221at2759
OrthoFinder 1 1.000 - - FOG0001103
OrthoInspector 1 1.000 - - mtm1125
orthoMCL 1 0.900 - - OOG6_101935
Panther 1 1.100 - - O PTHR10485
Phylome 1 0.910 - -
SonicParanoid 1 1.000 - - X753
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 1 0.960 - -
1312.830

Return to query results.
Submit another query.