DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment Tim17b and timm17b

DIOPT Version :9

Sequence 1:NP_001015401.1 Gene:Tim17b / 3355107 FlyBaseID:FBgn0263977 Length:173 Species:Drosophila melanogaster
Sequence 2:NP_001072242.1 Gene:timm17b / 779691 XenbaseID:XB-GENE-6454019 Length:156 Species:Xenopus tropicalis


Alignment Length:155 Identity:108/155 - (69%)
Similarity:127/155 - (81%) Gaps:2/155 - (1%)


- Green bases have known domain annotations that are detailed below.


  Fly     1 MEEYAREPCPYRIVDDCGGAFAMGCIGGGVFQAIKGFRNAPSGLNRRLVGSIIAIKTRSPVIAGN 65
            ||||.|||||:||||||||||.||.||||||||:|||||||:|:..||.||:.|::.|:|.|.|:
 Frog     1 MEEYMREPCPWRIVDDCGGAFTMGIIGGGVFQAVKGFRNAPAGVAHRLRGSMSAVRIRAPQIGGS 65

  Fly    66 FAVWGGMFSTIDCTLVHFRKKEDPWNSIISGAATGGILAARNGVPAMAGSAIIGGVLLALIEGVG 130
            ||||||:||||||.||..|.||||||||.|||.||.:||:|:|..||.|||::||:|||||||||
 Frog    66 FAVWGGLFSTIDCGLVRLRGKEDPWNSITSGALTGAVLASRSGPLAMVGSALMGGILLALIEGVG 130

  Fly   131 ILFTRISADQFKNPIPPAED--PVA 153
            ||.||.:|.||:||.|..|:  |||
 Frog   131 ILLTRYTAQQFQNPNPFGEESSPVA 155

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
Tim17bNP_001015401.1 Tim17 1..155 CDD:295283 108/155 (70%)
timm17bNP_001072242.1 Tim17 1..146 CDD:321914 103/144 (72%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 1 1.000 167 1.000 Domainoid score I3798
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 1 1.050 220 1.000 Inparanoid score I3458
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 1 1.000 - - FOG0001103
OrthoInspector 1 1.000 - - mtm9374
Panther 00.000 Not matched by this tool.
Phylome 00.000 Not matched by this tool.
RoundUp 00.000 Not matched by this tool.
SonicParanoid 1 1.000 - - X753
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
55.050

Return to query results.
Submit another query.