DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment Tim17b and Timm23

DIOPT Version :9

Sequence 1:NP_001015401.1 Gene:Tim17b / 3355107 FlyBaseID:FBgn0263977 Length:173 Species:Drosophila melanogaster
Sequence 2:NP_062225.1 Gene:Timm23 / 54312 RGDID:3863 Length:209 Species:Rattus norvegicus


Alignment Length:121 Identity:27/121 - (22%)
Similarity:48/121 - (39%) Gaps:24/121 - (19%)


- Green bases have known domain annotations that are detailed below.


  Fly    21 FAMG--CIGGGVFQAIKGFR-------NAPSGLNRRLVGSIIAIKTRSPVIAGNFAVWGG----- 71
            |.:|  |:.|..|.|:.|.|       :.|....|.:  .|:.:.||..      |:|..     
  Rat    78 FTIGGCCMTGAAFGALNGLRLGLKETQSMPWSKPRNV--QILNMVTRQG------ALWANTLGSL 134

  Fly    72 --MFSTIDCTLVHFRKKEDPWNSIISGAATGGILAARNGVPAMAGSAIIGGVLLAL 125
              ::|.....:...|..||.:|::.:|..||.:.....|:..:|...:.|..|.::
  Rat   135 ALLYSAFGVIIEKTRGAEDDFNTVAAGTMTGMLYKCTGGLRGIARGGLAGLTLTSV 190

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
Tim17bNP_001015401.1 Tim17 1..155 CDD:295283 27/121 (22%)
Timm23NP_062225.1 3a0801s02tim23 46..191 CDD:130056 27/121 (22%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 1 0.900 - - E1_COG5596
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
21.810

Return to query results.
Submit another query.