DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment Tim17b and timm17a

DIOPT Version :9

Sequence 1:NP_001015401.1 Gene:Tim17b / 3355107 FlyBaseID:FBgn0263977 Length:173 Species:Drosophila melanogaster
Sequence 2:NP_938181.1 Gene:timm17a / 386636 ZFINID:ZDB-GENE-031030-6 Length:166 Species:Danio rerio


Alignment Length:175 Identity:112/175 - (64%)
Similarity:132/175 - (75%) Gaps:11/175 - (6%)


- Green bases have known domain annotations that are detailed below.


  Fly     1 MEEYAREPCPYRIVDDCGGAFAMGCIGGGVFQAIKGFRNAPSGLNRRLVGSIIAIKTRSPVIAGN 65
            ||||||||||:||||||||||.||.||||:|||:|||||:|||:|.|:.||:.||:||:|.:.|:
Zfish     1 MEEYAREPCPWRIVDDCGGAFTMGAIGGGIFQAVKGFRNSPSGMNHRMKGSLTAIRTRAPQLGGS 65

  Fly    66 FAVWGGMFSTIDCTLVHFRKKEDPWNSIISGAATGGILAARNGVPAMAGSAIIGGVLLALIEGVG 130
            ||||||:||.|||.||..|.||||||||.|||.||.|||||||..||.|||.:||:|||||||.|
Zfish    66 FAVWGGLFSMIDCGLVKVRGKEDPWNSITSGAMTGAILAARNGPVAMVGSAAMGGILLALIEGAG 130

  Fly   131 ILFTRISADQFKNPIPP--AEDPVALGDPGRNFSFESASNRTQYQ 173
            ||.||.::.||  |..|  ||:|..:  |..:|     .:..|||
Zfish   131 ILLTRFASAQF--PTGPQFAEEPAPM--PTSSF-----GDYRQYQ 166

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
Tim17bNP_001015401.1 Tim17 1..155 CDD:295283 107/155 (69%)
timm17aNP_938181.1 Tim17 1..166 CDD:295283 110/173 (64%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 1 0.930 - - C170586882
Domainoid 1 1.000 169 1.000 Domainoid score I3766
eggNOG 1 0.900 - - E1_COG5596
Hieranoid 1 1.000 - -
Homologene 00.000 Not matched by this tool.
Inparanoid 1 1.050 223 1.000 Inparanoid score I3502
OMA 1 1.010 - - QHG54844
OrthoDB 1 1.010 - - D1590221at2759
OrthoFinder 1 1.000 - - FOG0001103
OrthoInspector 1 1.000 - - mtm6432
orthoMCL 1 0.900 - - OOG6_101935
Panther 1 1.100 - - O PTHR10485
Phylome 1 0.910 - -
RoundUp 1 1.030 - avgDist Average_Evolutionary_Distance R2313
SonicParanoid 1 1.000 - - X753
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
ZFIN 00.000 Not matched by this tool.
1413.840

Return to query results.
Submit another query.