DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment Tim17b and tim17

DIOPT Version :9

Sequence 1:NP_001015401.1 Gene:Tim17b / 3355107 FlyBaseID:FBgn0263977 Length:173 Species:Drosophila melanogaster
Sequence 2:NP_593342.1 Gene:tim17 / 2543163 PomBaseID:SPAC3A12.16c Length:164 Species:Schizosaccharomyces pombe


Alignment Length:145 Identity:72/145 - (49%)
Similarity:100/145 - (68%) Gaps:3/145 - (2%)


- Green bases have known domain annotations that are detailed below.


  Fly     3 EYAREPCPYRIVDDCGGAFAMGCIGGGVFQAIKGFRNAPSGLNRRLVGSIIAIKTRSPVIAGNFA 67
            ::.|:||||.|::|.|.||:||.|||.::.:|||:||:|.|..|  :.:|.|.|||:||:.|||.
pombe     5 DHTRDPCPYVILNDFGAAFSMGTIGGAIWHSIKGWRNSPPGEKR--ISAIAAAKTRAPVLGGNFG 67

  Fly    68 VWGGMFSTIDCTLVHFRKKEDPWNSIISGAATGGILAARNGVPAMAGSAIIGGVLLALIEGVGIL 132
            ||||:|||.||.:...|:||||||:||:|..|||.||.|.|..|....||....:||:.||:||.
pombe    68 VWGGLFSTFDCAVKGVRRKEDPWNAIIAGFFTGGALAVRGGWRATRNGAIGCACILAVFEGLGIA 132

  Fly   133 FTRISADQFKNPIPP 147
            ..|::| ::..|:.|
pombe   133 LGRMNA-EYNRPVAP 146

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
Tim17bNP_001015401.1 Tim17 1..155 CDD:295283 72/145 (50%)
tim17NP_593342.1 Tim17 3..162 CDD:295283 72/145 (50%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Domainoid 1 1.000 118 1.000 Domainoid score I1485
eggNOG 1 0.900 - - E1_COG5596
Hieranoid 1 1.000 - -
Homologene 1 1.000 - - H4620
Inparanoid 1 1.050 150 1.000 Inparanoid score I1309
OMA 1 1.010 - - QHG54844
OrthoFinder 1 1.000 - - FOG0001103
OrthoInspector 1 1.000 - - otm47021
orthoMCL 1 0.900 - - OOG6_101935
Panther 1 1.100 - - LDO PTHR10485
Phylome 1 0.910 - -
RoundUp 1 1.030 - avgDist Average_Evolutionary_Distance R2313
SonicParanoid 1 1.000 - - X753
TreeFam 1 0.960 - -
1413.860

Return to query results.
Submit another query.