DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment Tim17b and Timm17b

DIOPT Version :9

Sequence 1:NP_001015401.1 Gene:Tim17b / 3355107 FlyBaseID:FBgn0263977 Length:173 Species:Drosophila melanogaster
Sequence 2:NP_035721.1 Gene:Timm17b / 21855 MGIID:1343176 Length:172 Species:Mus musculus


Alignment Length:176 Identity:114/176 - (64%)
Similarity:130/176 - (73%) Gaps:9/176 - (5%)


- Green bases have known domain annotations that are detailed below.


  Fly     1 MEEYAREPCPYRIVDDCGGAFAMGCIGGGVFQAIKGFRNAPSGLNRRLVGSIIAIKTRSPVIAGN 65
            ||||||||||:||||||||||.||.||||||||||||||||.|:..|..||:.|::.|:|.|.|:
Mouse     1 MEEYAREPCPWRIVDDCGGAFTMGVIGGGVFQAIKGFRNAPVGIRHRFRGSVNAVRIRAPQIGGS 65

  Fly    66 FAVWGGMFSTIDCTLVHFRKKEDPWNSIISGAATGGILAARNGVPAMAGSAIIGGVLLALIEGVG 130
            ||||||:||||||.||..|.||||||||.|||.||.:||||:|..||.|||::||:|||||||||
Mouse    66 FAVWGGLFSTIDCGLVRLRGKEDPWNSISSGALTGAVLAARSGPLAMVGSAMMGGILLALIEGVG 130

  Fly   131 ILFTRISADQFKNPIPPAEDPVAL----GDPGRNFSFESASNRTQY 172
            ||.||.:|.||:|..|..|||..|    |.|...:     .|..||
Mouse   131 ILLTRYTAQQFRNAPPFLEDPSQLTPKEGSPAPGY-----PNYQQY 171

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
Tim17bNP_001015401.1 Tim17 1..155 CDD:295283 109/157 (69%)
Timm17bNP_035721.1 Tim17 1..171 CDD:295283 112/174 (64%)
Disordered. /evidence=ECO:0000256|SAM:MobiDB-lite 147..172 9/30 (30%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 1 0.930 - - C167842454
Domainoid 1 1.000 170 1.000 Domainoid score I3755
eggNOG 1 0.900 - - E1_COG5596
Hieranoid 1 1.000 - -
Homologene 1 1.000 - - H4620
Inparanoid 1 1.050 225 1.000 Inparanoid score I3486
Isobase 1 0.950 - 0 Normalized mean entropy S575
OMA 1 1.010 - - QHG54844
OrthoDB 1 1.010 - - D1590221at2759
OrthoFinder 1 1.000 - - FOG0001103
OrthoInspector 1 1.000 - - mtm8714
orthoMCL 1 0.900 - - OOG6_101935
Panther 1 1.100 - - LDO PTHR10485
Phylome 1 0.910 - -
RoundUp 1 1.030 - avgDist Average_Evolutionary_Distance R2313
SonicParanoid 1 1.000 - - X753
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 1 0.960 - -
1716.750

Return to query results.
Submit another query.