DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment Tim17b and tctn-1

DIOPT Version :10

Sequence 1:NP_001015401.1 Gene:Tim17b / 3355107 FlyBaseID:FBgn0263977 Length:173 Species:Drosophila melanogaster
Sequence 2:NP_500628.2 Gene:tctn-1 / 184035 WormBaseID:WBGene00017120 Length:470 Species:Caenorhabditis elegans


Alignment Length:85 Identity:20/85 - (23%)
Similarity:31/85 - (36%) Gaps:26/85 - (30%)


- Green bases have known domain annotations that are detailed below.


  Fly    74 STIDCTLVHFRKKEDPWNSIISGAATGGILAARNGVPAMAGSAIIGGVLLALIEGVGILFTRISA 138
            |||.|.|        |.:|::.      |..::.|........||.|....|::.|..|    |.
 Worm   358 STISCRL--------PVSSLLQ------IYYSKQGSTKNYREVIIAGNSQLLLDDVPYL----SG 404

  Fly   139 DQFKNPI--------PPAED 150
            .:.:.||        ||.::
 Worm   405 QEIRMPISISFTEVTPPPKN 424

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
Tim17bNP_001015401.1 TIM22 1..155 CDD:470560 20/85 (24%)
tctn-1NP_500628.2 None

Return to query results.
Submit another query.