powered by:
Protein Alignment Tim17b and C47G2.3
DIOPT Version :9
Sequence 1: | NP_001015401.1 |
Gene: | Tim17b / 3355107 |
FlyBaseID: | FBgn0263977 |
Length: | 173 |
Species: | Drosophila melanogaster |
Sequence 2: | NP_496412.1 |
Gene: | C47G2.3 / 174722 |
WormBaseID: | WBGene00008164 |
Length: | 213 |
Species: | Caenorhabditis elegans |
Alignment Length: | 53 |
Identity: | 23/53 - (43%) |
Similarity: | 28/53 - (52%) |
Gaps: | 1/53 - (1%) |
- Green bases have known domain annotations that are detailed below.
Fly 65 NFAVWGGMFSTIDCTLVHFRKKEDPWNSIISGAATGGILAARNGV-PAMAGSA 116
||...|.|||..:|.|...|.|.|..|...||...||:|..|.|: ||:.|:|
Worm 146 NFGSIGLMFSGTECALETIRAKSDWRNGTYSGGIVGGLLGLRAGIMPAVWGAA 198
|
Known Domains:
Indicated by green bases in alignment.
Gene | Sequence | Domain | Region |
External ID | Identity |
Tim17b | NP_001015401.1 |
Tim17 |
1..155 |
CDD:295283 |
23/53 (43%) |
C47G2.3 | NP_496412.1 |
Tim17 |
86..208 |
CDD:280604 |
23/53 (43%) |
Information from Original Tools:
Tool |
Simple Score |
Weighted Score |
Original Tool Information |
BLAST Result |
Score |
Score Type |
Cluster ID |
Compara |
0 | 0.000 |
Not matched by this tool. |
Domainoid |
0 | 0.000 |
Not matched by this tool. |
eggNOG |
1 |
0.900 |
- |
- |
|
E1_COG5596 |
Hieranoid |
0 | 0.000 |
Not matched by this tool. |
Homologene |
0 | 0.000 |
Not matched by this tool. |
Inparanoid |
0 | 0.000 |
Not matched by this tool. |
Isobase |
0 | 0.000 |
Not matched by this tool. |
OMA |
0 | 0.000 |
Not matched by this tool. |
OrthoDB |
0 | 0.000 |
Not matched by this tool. |
OrthoFinder |
0 | 0.000 |
Not matched by this tool. |
OrthoInspector |
0 | 0.000 |
Not matched by this tool. |
orthoMCL |
0 | 0.000 |
Not matched by this tool. |
Panther |
0 | 0.000 |
Not matched by this tool. |
Phylome |
1 |
0.910 |
- |
- |
|
|
RoundUp |
0 | 0.000 |
Not matched by this tool. |
SonicParanoid |
0 | 0.000 |
Not matched by this tool. |
SwiftOrtho |
0 | 0.000 |
Not matched by this tool. |
TreeFam |
0 | 0.000 |
Not matched by this tool. |
|
2 | 1.810 |
|
Return to query results.
Submit another query.