DRSC - DRSC Integrative Ortholog Prediction Tool

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits

Protein Alignment Alg-2 and CAPNS2

DIOPT Version :9

Sequence 1:	NP_001104459.2	Gene:	Alg-2 / 3355106	FlyBaseID:	FBgn0086378	Length:	178	Species:	Drosophila melanogaster
Sequence 2:	NP_115706.1	Gene:	CAPNS2 / 84290	HGNCID:	16371	Length:	248	Species:	Homo sapiens

Alignment Length:	127	Identity:	37/127 - (29%)
Similarity:	78/127 - (61%)	Gaps:	1/127 - (0%)

- Green bases have known domain annotations that are detailed below.

  Fly    46 FNPETIRLMIGMFDRENKGTVSFKDFGALWKYVTDWQNCFRSFDRDNSGNIDKTELKTALTSFGY 110
            |:.:|.|.::.:.|.:..|.:.|::|..||..:..||..::.:|||:||::..::|:.||.:.|:
Human   119 FSLDTCRSIVSVMDSDTTGKLGFEEFKYLWNNIKKWQCVYKQYDRDHSGSLGSSQLRGALQAAGF 183

  Fly   111 RLSDHLIDVLLRKFDRFGRGTILFDDFIQCCIVLYTLTTAFRQHDTDLDGIITIHYEQFLSM 172
            :|::.|..:::|::.. ..|.:.|::||.|.:.|..:..||:..|.|.||:|.:..:::|.:
Human   184 QLNEQLYQMIVRRYAN-EDGDMDFNNFISCLVRLDAMFRAFKSLDRDRDGLIQVSIKEWLQL 244

Known Domains:

Indicated by green bases in alignment.

Gene	Sequence	Domain	Region	External ID	Identity
Alg-2	NP_001104459.2	EF-hand_7	16..71	CDD:290234	6/24 (25%)
		EFh	16..71	CDD:238008	6/24 (25%)
		EF-hand_7	82..139	CDD:290234	16/56 (29%)
		EFh	85..139	CDD:238008	15/53 (28%)
CAPNS2	NP_115706.1	EFh_PEF_CPNS1_2	80..248	CDD:320063	37/127 (29%)
		EF-hand motif	80..108	CDD:320063
		EF-hand motif	122..152	CDD:320063	8/29 (28%)
		EF-hand motif	153..183	CDD:320063	10/29 (34%)
		EF-hand motif	189..217	CDD:320063	7/28 (25%)
		EF-hand motif	218..248	CDD:320063	8/27 (30%)
Blue background indicates that the domain is not in the aligned region.

Information from Original Tools:

Tool	Simple Score	Weighted Score	Original Tool Information
Tool	Simple Score	Weighted Score	BLAST Result	Score	Score Type	Cluster ID
Compara	0	0.000	Not matched by this tool.
Domainoid	0	0.000	Not matched by this tool.
eggNOG	0	0.000	Not matched by this tool.
Hieranoid	0	0.000	Not matched by this tool.
Homologene	0	0.000	Not matched by this tool.
Inparanoid	0	0.000	Not matched by this tool.
Isobase	0	0.000	Not matched by this tool.
OMA	0	0.000	Not matched by this tool.
OrthoDB	1	1.010	-	-		D1330600at2759
OrthoFinder	0	0.000	Not matched by this tool.
OrthoInspector	0	0.000	Not matched by this tool.
orthoMCL	0	0.000	Not matched by this tool.
Panther	0	0.000	Not matched by this tool.
Phylome	1	0.910	-	-
RoundUp	0	0.000	Not matched by this tool.
SonicParanoid	0	0.000	Not matched by this tool.
SwiftOrtho	1	1.000	-	-
TreeFam	0	0.000	Not matched by this tool.
User_Submission	0	0.000	Not matched by this tool.
	3	2.920