DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment Alg-2 and CAPNS1

DIOPT Version :9

Sequence 1:NP_001104459.2 Gene:Alg-2 / 3355106 FlyBaseID:FBgn0086378 Length:178 Species:Drosophila melanogaster
Sequence 2:XP_005259352.1 Gene:CAPNS1 / 826 HGNCID:1481 Length:322 Species:Homo sapiens


Alignment Length:161 Identity:47/161 - (29%)
Similarity:82/161 - (50%) Gaps:11/161 - (6%)


- Green bases have known domain annotations that are detailed below.


  Fly    18 FQRVDKDRSG---HISADELQVALSNGT-------WSAFNPETIRLMIGMFDRENKGTVSFKDFG 72
            |:|:....:|   .:||.||...|:...       ...|..:|.|.|:.:.|.:..|.:.|::|.
Human   101 FRRLFAQLAGDDMEVSATELMNILNKVVTRHPDLKTDGFGIDTCRSMVAVMDSDTTGKLGFEEFK 165

  Fly    73 ALWKYVTDWQNCFRSFDRDNSGNIDKTELKTALTSFGYRLSDHLIDVLLRKFDRFGRGTILFDDF 137
            .||..:..||..::.||.|.||.|..:||..|..:.|:.|::||.::::|::.. ..|.:.||:|
Human   166 YLWNNIKRWQAIYKQFDTDRSGTICSSELPGAFEAAGFHLNEHLYNMIIRRYSD-ESGNMDFDNF 229

  Fly   138 IQCCIVLYTLTTAFRQHDTDLDGIITIHYEQ 168
            |.|.:.|..:..||:..|.|..|.|.::.::
Human   230 ISCLVRLDAMFRAFKSLDKDGTGQIQVNIQE 260

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
Alg-2NP_001104459.2 EF-hand_7 16..71 CDD:290234 15/62 (24%)
EFh 16..71 CDD:238008 15/62 (24%)
EF-hand_7 82..139 CDD:290234 19/56 (34%)
EFh 85..139 CDD:238008 18/53 (34%)
CAPNS1XP_005259352.1 EFh_PEF_CPNS1_2 100..260 CDD:320063 47/159 (30%)
EF-hand motif 100..128 CDD:320063 8/26 (31%)
EF-hand motif 142..172 CDD:320063 9/29 (31%)
EF-hand motif 173..203 CDD:320063 11/29 (38%)
EF-hand motif 209..237 CDD:320063 8/28 (29%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 1 1.010 - - D1330600at2759
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
User_Submission 00.000 Not matched by this tool.
21.920

Return to query results.
Submit another query.