DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment Alg-2 and AT3G10300

DIOPT Version :9

Sequence 1:NP_001104459.2 Gene:Alg-2 / 3355106 FlyBaseID:FBgn0086378 Length:178 Species:Drosophila melanogaster
Sequence 2:NP_001327262.1 Gene:AT3G10300 / 820192 AraportID:AT3G10300 Length:377 Species:Arabidopsis thaliana


Alignment Length:129 Identity:50/129 - (38%)
Similarity:79/129 - (61%) Gaps:3/129 - (2%)


- Green bases have known domain annotations that are detailed below.


  Fly    18 FQRVDKDRSGHISADELQVALSNGTWSAFNPETIRLMIGMFDRENKGTVSFKDFGALWKYVTDWQ 82
            ||..|:|.||.|...|||.|||:...| |:..|:.|::.:|...|...:..|:|.:|:..:.:|:
plant   173 FQAADRDNSGFIDDKELQGALSSYNQS-FSIRTVHLLMYLFTNSNVRKIGPKEFTSLFFSLQNWR 236

  Fly    83 NCFRSFDRDNSGNIDKTELKTALTSFGYRLSDHLIDVLLRKFDRFG--RGTILFDDFIQCCIVL 144
            :.|..||:|.||.||..||:.||.|.|:.:|..::|:|:.|||:.|  ...|.:|:||:||:.:
plant   237 SIFERFDKDRSGRIDTNELRDALMSLGFSVSPVILDLLVSKFDKSGGRNRAIEYDNFIECCLTV 300

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
Alg-2NP_001104459.2 EF-hand_7 16..71 CDD:290234 20/52 (38%)
EFh 16..71 CDD:238008 20/52 (38%)
EF-hand_7 82..139 CDD:290234 24/58 (41%)
EFh 85..139 CDD:238008 24/55 (44%)
AT3G10300NP_001327262.1 None


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 1 1.010 - - QHG54126
OrthoDB 1 1.010 - - D1330600at2759
OrthoFinder 1 1.000 - - FOG0000697
OrthoInspector 1 1.000 - - mtm1073
orthoMCL 1 0.900 - - OOG6_100410
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
SonicParanoid 1 1.000 - - X1327
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
76.830

Return to query results.
Submit another query.