DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment Alg-2 and AT2G27480

DIOPT Version :9

Sequence 1:NP_001104459.2 Gene:Alg-2 / 3355106 FlyBaseID:FBgn0086378 Length:178 Species:Drosophila melanogaster
Sequence 2:NP_180317.3 Gene:AT2G27480 / 817293 AraportID:AT2G27480 Length:228 Species:Arabidopsis thaliana


Alignment Length:199 Identity:55/199 - (27%)
Similarity:94/199 - (47%) Gaps:31/199 - (15%)


- Green bases have known domain annotations that are detailed below.


  Fly     5 HDG-----------MPDQQF--------------LWDVFQRVDKDRSGHISADELQVALSNGTWS 44
            |||           .|.|||              :...|:..|::|||.:...||:.|||...:.
plant    23 HDGESRYTYAYPSYQPTQQFSSYSGMFSPETHPEIVRSFESADRNRSGFLEESELRQALSLSGYD 87

  Fly    45 AFNPETIRLMIGMFDRENKGTVSF--KDFGALWKYVTDWQNCFRSFDRDNSGNIDKTELKTALTS 107
            ..:..||||::.::.......:..  |::..||..:..|:..|..:|||.||.::.|:|:.|..:
plant    88 GISNRTIRLLLFIYKIPVDSLLRLGPKEYVELWNCLAQWRAIFNRYDRDRSGKMNSTQLRDAFYN 152

  Fly   108 FGYRLSDHLIDVLLRKFDRFGRG---TILFDDFIQCCIVLYTLTTAFRQHDTDLDGIITIHYEQF 169
            .|..|...:..:::.:||. |.|   .:.||.|::|.:::..||..||::|....|..|:.|:.|
plant   153 LGCVLPTSVHQLIVSQFDD-GTGKTVDLCFDSFLECGMIVKGLTEKFRENDPGYTGYATLSYDVF 216

  Fly   170 LSMV 173
            :.||
plant   217 MLMV 220

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
Alg-2NP_001104459.2 EF-hand_7 16..71 CDD:290234 15/56 (27%)
EFh 16..71 CDD:238008 15/56 (27%)
EF-hand_7 82..139 CDD:290234 18/59 (31%)
EFh 85..139 CDD:238008 18/56 (32%)
AT2G27480NP_180317.3 EFh_PEF_Group_I 56..223 CDD:320055 48/166 (29%)
EF-hand motif 56..85 CDD:320055 10/28 (36%)
EF-hand motif 93..124 CDD:320055 7/30 (23%)
EF-hand motif 125..154 CDD:320055 10/28 (36%)
EF-hand motif 161..192 CDD:320055 8/31 (26%)
EF-hand motif 193..223 CDD:320055 11/28 (39%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 1 1.050 86 1.000 Inparanoid score I2334
OMA 1 1.010 - - QHG54126
OrthoDB 1 1.010 - - D1330600at2759
OrthoFinder 1 1.000 - - FOG0000697
OrthoInspector 1 1.000 - - mtm1073
orthoMCL 1 0.900 - - OOG6_100410
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
SonicParanoid 1 1.000 - - X1327
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
87.880

Return to query results.
Submit another query.