DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment Alg-2 and Capns2

DIOPT Version :9

Sequence 1:NP_001104459.2 Gene:Alg-2 / 3355106 FlyBaseID:FBgn0086378 Length:178 Species:Drosophila melanogaster
Sequence 2:NP_001102850.1 Gene:Capns2 / 679870 RGDID:1583620 Length:247 Species:Rattus norvegicus


Alignment Length:158 Identity:43/158 - (27%)
Similarity:86/158 - (54%) Gaps:13/158 - (8%)


- Green bases have known domain annotations that are detailed below.


  Fly    16 DVFQRVDKDRSGHISADELQVALSNGTWSAFNPETIRLMIGMFDRENKGTVSFKDFGALWKYVTD 80
            |:...::|..|.|   .||:.       ..|:.:|.|.::.:.|.:..|.:.|::|..||..:..
  Rat    98 DLMNILNKVLSKH---KELKT-------DGFSLDTCRSIVSVMDSDTTGKLGFEEFKYLWNNIKK 152

  Fly    81 WQNCFRSFDRDNSGNIDKTELKTALTSFGYRLSDHLIDVLLRKF-DRFGRGTILFDDFIQCCIVL 144
            ||..|:.:|.|:||.:..::|..|:.:.|::|::.|..:::|:: |.  .|::.|::||.|.:.|
  Rat   153 WQCVFKQYDSDHSGFLRSSQLHGAMQAAGFQLNEQLYLMIVRRYADE--DGSMDFNNFISCLVRL 215

  Fly   145 YTLTTAFRQHDTDLDGIITIHYEQFLSM 172
            ..:..||:..|.|.||:|.:...::|.:
  Rat   216 DAMFRAFKTLDRDRDGLIRVSIREWLQL 243

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
Alg-2NP_001104459.2 EF-hand_7 16..71 CDD:290234 12/54 (22%)
EFh 16..71 CDD:238008 12/54 (22%)
EF-hand_7 82..139 CDD:290234 16/57 (28%)
EFh 85..139 CDD:238008 15/54 (28%)
Capns2NP_001102850.1 EFh 123..168 CDD:298682 14/44 (32%)
EF-hand_7 154..209 CDD:290234 15/56 (27%)
EFh 154..209 CDD:298682 15/56 (27%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 1 1.010 - - D1330600at2759
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
11.010

Return to query results.
Submit another query.