DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment Alg-2 and capn2b

DIOPT Version :9

Sequence 1:NP_001104459.2 Gene:Alg-2 / 3355106 FlyBaseID:FBgn0086378 Length:178 Species:Drosophila melanogaster
Sequence 2:NP_001018177.1 Gene:capn2b / 563053 ZFINID:ZDB-GENE-050522-84 Length:696 Species:Danio rerio


Alignment Length:168 Identity:45/168 - (26%)
Similarity:81/168 - (48%) Gaps:18/168 - (10%)


- Green bases have known domain annotations that are detailed below.


  Fly     9 PDQQF----LWDVFQRVDKDRSGHISADELQVALSNGTWSAFNPETIRLMIGMFDRENKGTVSFK 69
            ||.:.    |..:|.::...|:...|             |.|..:|.|:|:.:.|....|.:...
Zfish   540 PDMEISPLELMTIFNKIIAKRTDIKS-------------STFTLDTCRVMVNLMDDSGNGKLGLG 591

  Fly    70 DFGALWKYVTDWQNCFRSFDRDNSGNIDKTELKTALTSFGYRLSDHLIDVLLRKFDRFGRGTILF 134
            :|..|||.|..:...|:..|.|:||.|...||:.||...|:.|::.|..:::.::..... |:||
Zfish   592 EFATLWKKVQRYLEIFKHNDLDSSGTISTPELRMALKEAGFCLNNTLFQLMVARYAEKDM-TLLF 655

  Fly   135 DDFIQCCIVLYTLTTAFRQHDTDLDGIITIHYEQFLSM 172
            |:|:.|.:.|..:..||::.|....|.|.:::.|:|::
Zfish   656 DNFVSCLMRLEMMFRAFKRLDPHKSGFIELNFNQWLNL 693

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
Alg-2NP_001104459.2 EF-hand_7 16..71 CDD:290234 10/54 (19%)
EFh 16..71 CDD:238008 10/54 (19%)
EF-hand_7 82..139 CDD:290234 18/56 (32%)
EFh 85..139 CDD:238008 18/53 (34%)
capn2bNP_001018177.1 Peptidase_C2 46..339 CDD:279042
Calpain_III 354..503 CDD:279416
EFh 573..628 CDD:238008 18/54 (33%)
FRQ1 601..>686 CDD:227455 25/85 (29%)
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
ZFIN 00.000 Not matched by this tool.
10.910

Return to query results.
Submit another query.