DRSC - DRSC Integrative Ortholog Prediction Tool

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits

Protein Alignment Alg-2 and si:ch211-202f3.3

DIOPT Version :9

Sequence 1:	NP_001104459.2	Gene:	Alg-2 / 3355106	FlyBaseID:	FBgn0086378	Length:	178	Species:	Drosophila melanogaster
Sequence 2:	XP_017207337.2	Gene:	si:ch211-202f3.3 / 553353	ZFINID:	ZDB-GENE-080917-19	Length:	846	Species:	Danio rerio

Alignment Length:	139	Identity:	35/139 - (25%)
Similarity:	66/139 - (47%)	Gaps:	13/139 - (9%)

- Green bases have known domain annotations that are detailed below.

  Fly    12 QFLW----DVFQRVDKDRSGHISADELQVALSNGTWSAFNPETIRLMIGMFDRENKGTVSFKDFG 72
            :||:    |.::.||.::...|..:.|.....|.  ..|..::.|.||.|.|....|.:...:|.
Zfish   683 KFLFRQYSDQYKVVDAEKLQQILHENLLRGRKNA--EGFGLDSCRSMIAMSDFCVTGRLQGSEFV 745

  Fly    73 ALWKYVTDWQNCFRSFDRDNSGNIDKTELKTALTSFGYRLSDHLIDVLLRKFDRFGRGT--ILFD 135
            .||..:|.:::.|.:.|....|.:...||:.||...|..|::.::::::   .|:|..:  |..:
Zfish   746 RLWDRITTYRDIFYNMDSSKDGVLSLNELQNALEKTGLHLNEDILNLMV---VRYGGASEQISLE 807

  Fly   136 DFIQCCIVL 144
            .||  |:|:
Zfish   808 GFI--CLVM 814

Known Domains:

Indicated by green bases in alignment.

Gene	Sequence	Domain	Region	External ID	Identity
Alg-2	NP_001104459.2	EF-hand_7	16..71	CDD:290234	13/54 (24%)
		EFh	16..71	CDD:238008	13/54 (24%)
		EF-hand_7	82..139	CDD:290234	13/58 (22%)
		EFh	85..139	CDD:238008	13/55 (24%)
si:ch211-202f3.3	XP_017207337.2	Peptidase_C2	198..487	CDD:306994
		Calpain_III	509..647	CDD:307285
		EFh_PEF_CAPN13_14	683..846	CDD:320070	35/139 (25%)
		EF-hand motif	683..709	CDD:320070	6/25 (24%)
		EF-hand motif	723..752	CDD:320070	9/28 (32%)
		EF-hand motif	753..783	CDD:320070	7/29 (24%)
		EF-hand motif	789..817	CDD:320070	7/31 (23%)
		EF-hand motif	819..846	CDD:320070
Blue background indicates that the domain is not in the aligned region.

Information from Original Tools:

Tool	Simple Score	Weighted Score	Original Tool Information
Tool	Simple Score	Weighted Score	BLAST Result	Score	Score Type	Cluster ID
Compara	0	0.000	Not matched by this tool.
Domainoid	0	0.000	Not matched by this tool.
eggNOG	0	0.000	Not matched by this tool.
Hieranoid	0	0.000	Not matched by this tool.
Homologene	0	0.000	Not matched by this tool.
Inparanoid	0	0.000	Not matched by this tool.
OMA	0	0.000	Not matched by this tool.
OrthoDB	0	0.000	Not matched by this tool.
OrthoFinder	0	0.000	Not matched by this tool.
OrthoInspector	0	0.000	Not matched by this tool.
orthoMCL	0	0.000	Not matched by this tool.
Panther	0	0.000	Not matched by this tool.
Phylome	1	0.910	-	-
RoundUp	0	0.000	Not matched by this tool.
SonicParanoid	0	0.000	Not matched by this tool.
SwiftOrtho	0	0.000	Not matched by this tool.
TreeFam	0	0.000	Not matched by this tool.
ZFIN	0	0.000	Not matched by this tool.
	1	0.910