DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment Alg-2 and capns1a

DIOPT Version :9

Sequence 1:NP_001104459.2 Gene:Alg-2 / 3355106 FlyBaseID:FBgn0086378 Length:178 Species:Drosophila melanogaster
Sequence 2:NP_001017899.2 Gene:capns1a / 550598 ZFINID:ZDB-GENE-030113-3 Length:216 Species:Danio rerio


Alignment Length:178 Identity:51/178 - (28%)
Similarity:94/178 - (52%) Gaps:10/178 - (5%)


- Green bases have known domain annotations that are detailed below.


  Fly     2 AYNHDGMPDQQFLWDVFQRVDKDRSGHISADEL-----QVALSNG--TWSAFNPETIRLMIGMFD 59
            |.:::...:|||. .||.::..| ...:|..||     ::...:|  ....|..|:.|.|:.:.|
Zfish    38 AVSNESAEEQQFR-KVFNQLAGD-DMEVSPTELMNILNKIISKHGDLKTDGFTIESCRSMVAVMD 100

  Fly    60 RENKGTVSFKDFGALWKYVTDWQNCFRSFDRDNSGNIDKTELKTALTSFGYRLSDHLIDVLLRKF 124
            .::.|.:.|.:|..||..:..||..::::|||:||.|...||..|..:.|:.|:|.|..:::|::
Zfish   101 SDSTGKLGFHEFKHLWNNIKKWQGIYKTYDRDHSGTIGADELPAAFRAAGFPLTDQLFQMIIRRY 165

  Fly   125 DRFGRGTILFDDFIQCCIVLYTLTTAFRQHDTDLDGIITIHYEQFLSM 172
            .. ..|.:.||::|.|.:.|..:..||:..|.|.||.|.::.:::|.:
Zfish   166 SD-ESGNMDFDNYIGCLVRLDAMCHAFKTLDKDNDGTIKVNVQEWLQL 212

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
Alg-2NP_001104459.2 EF-hand_7 16..71 CDD:290234 14/61 (23%)
EFh 16..71 CDD:238008 14/61 (23%)
EF-hand_7 82..139 CDD:290234 18/56 (32%)
EFh 85..139 CDD:238008 17/53 (32%)
capns1aNP_001017899.2 EFh 92..142 CDD:298682 16/49 (33%)
EFh 125..175 CDD:238008 15/50 (30%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 1 1.010 - - D1330600at2759
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
ZFIN 00.000 Not matched by this tool.
21.920

Return to query results.
Submit another query.