DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment Alg-2 and capns2

DIOPT Version :9

Sequence 1:NP_001104459.2 Gene:Alg-2 / 3355106 FlyBaseID:FBgn0086378 Length:178 Species:Drosophila melanogaster
Sequence 2:NP_001016161.1 Gene:capns2 / 548915 XenbaseID:XB-GENE-5764367 Length:234 Species:Xenopus tropicalis


Alignment Length:165 Identity:47/165 - (28%)
Similarity:89/165 - (53%) Gaps:11/165 - (6%)


- Green bases have known domain annotations that are detailed below.


  Fly    18 FQRVDKDRSG---HISADELQVALS-------NGTWSAFNPETIRLMIGMFDRENKGTVSFKDFG 72
            |:|:....:|   .:||.||...|:       :.....|:.::.|.|:.:.|.::.|.:.|::|.
 Frog    67 FRRLFSQLAGDDMEVSATELMGILNKVIAKHQDLKTDGFSADSCRSMVAVMDSDSTGKLGFEEFK 131

  Fly    73 ALWKYVTDWQNCFRSFDRDNSGNIDKTELKTALTSFGYRLSDHLIDVLLRKFDRFGRGTILFDDF 137
            .||..:..||..::.:|.|.||.|.:.||..|.|:.|::|:..|.|:::|::.. .:|.:.||::
 Frog   132 YLWDNIKKWQGVYKRYDTDRSGTIGRNELPGAFTAAGFQLNGQLYDMIIRRYSD-EKGDMDFDNY 195

  Fly   138 IQCCIVLYTLTTAFRQHDTDLDGIITIHYEQFLSM 172
            |.|.:.|..:..||:..|.|.||.|.:..:::|.:
 Frog   196 ICCLVRLDAMFRAFKTLDKDGDGQIKVTIQEWLQL 230

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
Alg-2NP_001104459.2 EF-hand_7 16..71 CDD:290234 14/62 (23%)
EFh 16..71 CDD:238008 14/62 (23%)
EF-hand_7 82..139 CDD:290234 18/56 (32%)
EFh 85..139 CDD:238008 17/53 (32%)
capns2NP_001016161.1 EFh_PEF_CPNS1_2 66..234 CDD:320063 47/165 (28%)
EF-hand motif 66..94 CDD:320063 8/26 (31%)
EF-hand motif 108..138 CDD:320063 8/29 (28%)
EF-hand motif 139..169 CDD:320063 11/29 (38%)
EF-hand motif 175..203 CDD:320063 8/28 (29%)
EF-hand motif 204..234 CDD:320063 8/27 (30%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 1 1.010 - - D1330600at2759
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
21.920

Return to query results.
Submit another query.