DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment Alg-2 and gca

DIOPT Version :9

Sequence 1:NP_001104459.2 Gene:Alg-2 / 3355106 FlyBaseID:FBgn0086378 Length:178 Species:Drosophila melanogaster
Sequence 2:NP_001005585.1 Gene:gca / 449543 ZFINID:ZDB-GENE-040930-3 Length:205 Species:Danio rerio


Alignment Length:172 Identity:56/172 - (32%)
Similarity:99/172 - (57%) Gaps:7/172 - (4%)


- Green bases have known domain annotations that are detailed below.


  Fly     9 PDQQFLWDVFQRVDKDRSGHISADELQVALS----NGTWSAFNPETIRLMIGMFDRENKGTVSFK 69
            |.|..:|..|..: ..:.|.:.|:|||..|:    :|:::.|:.||.|:||.:.||:..|.:.|.
Zfish    37 PAQDPMWGYFTAI-AGQDGEVDAEELQRCLTQTGISGSYTPFSLETCRIMIALLDRDYTGKMGFN 100

  Fly    70 DFGALWKYVTDWQNCFRSFDRDNSGNIDKTELKTALTSFGYRLSDHLIDVLLRKFDRFGRGTILF 134
            :|..|:..:..|:..|...|||:||.::..|:..::.:.|||:|..::|.:::::.|.|:  |.|
Zfish   101 EFKELFGVLNGWKQNFMMVDRDHSGTVEPYEMSQSIANMGYRVSPRVLDAIVKRYSRSGK--IYF 163

  Fly   135 DDFIQCCIVLYTLTTAFRQHDTDLDGIITIHYEQFLSMVFSL 176
            ||::.||:.|..||..||:.||...|::...|:.|:....||
Zfish   164 DDYVACCVKLKALTDHFRRRDTMQQGMVNFQYDDFILCTISL 205

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
Alg-2NP_001104459.2 EF-hand_7 16..71 CDD:290234 18/58 (31%)
EFh 16..71 CDD:238008 18/58 (31%)
EF-hand_7 82..139 CDD:290234 18/56 (32%)
EFh 85..139 CDD:238008 18/53 (34%)
gcaNP_001005585.1 EFh 52..106 CDD:298682 18/53 (34%)
EFh 82..132 CDD:298682 16/49 (33%)
EFh 116..168 CDD:298682 18/53 (34%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 1 1.010 - - QHG54126
OrthoDB 1 1.010 - - D1330600at2759
OrthoFinder 1 1.000 - - FOG0000697
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 1 0.900 - - OOG6_100410
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
ZFIN 00.000 Not matched by this tool.
54.830

Return to query results.
Submit another query.