DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment Alg-2 and pef1

DIOPT Version :9

Sequence 1:NP_001104459.2 Gene:Alg-2 / 3355106 FlyBaseID:FBgn0086378 Length:178 Species:Drosophila melanogaster
Sequence 2:NP_001003643.1 Gene:pef1 / 445249 ZFINID:ZDB-GENE-040801-259 Length:270 Species:Danio rerio


Alignment Length:166 Identity:69/166 - (41%)
Similarity:98/166 - (59%) Gaps:3/166 - (1%)


- Green bases have known domain annotations that are detailed below.


  Fly     7 GMPDQQFLWDVFQRVDKDRSGHISADELQVALSNGTWSAFNPETIRLMIGMFDRENKGTVSFKDF 71
            |:..:.:.|  |..||.|:||:|:|.||:.||.|...|:||.||..:|:.|||:...|.|....|
Zfish   100 GVNPEAYQW--FSTVDSDQSGYINAKELKQALMNFNNSSFNDETCIMMLNMFDKTKSGRVDVFGF 162

  Fly    72 GALWKYVTDWQNCFRSFDRDNSGNIDKTELKTALTSFGYRLSDHLIDVLLRKFD-RFGRGTILFD 135
            .|||.::..|:..|:.||||.||:|:..|:..||:..||.||...|..|:.::. |.|.|.:..|
Zfish   163 SALWTFLQQWRAAFQQFDRDRSGSINTNEMHQALSQMGYNLSPQFIQELVNRYSVRGGTGVLQLD 227

  Fly   136 DFIQCCIVLYTLTTAFRQHDTDLDGIITIHYEQFLS 171
            .|||.|..|.::|.|||:.||.:.|.:.:.||.|||
Zfish   228 RFIQVCTQLQSMTQAFREKDTGMTGNVRMSYEDFLS 263

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
Alg-2NP_001104459.2 EF-hand_7 16..71 CDD:290234 24/54 (44%)
EFh 16..71 CDD:238008 24/54 (44%)
EF-hand_7 82..139 CDD:290234 22/57 (39%)
EFh 85..139 CDD:238008 22/54 (41%)
pef1NP_001003643.1 Disordered. /evidence=ECO:0000256|SAM:MobiDB-lite 1..97
5 X 9 AA approximate tandem repeat of [AP]-P-G-G-P-Y-G-G-P-P 22..91
EFh 109..167 CDD:238008 27/57 (47%)
EF-hand_7 109..165 CDD:290234 25/55 (45%)
EF-hand_7 173..233 CDD:290234 24/59 (41%)
EFh 173..231 CDD:238008 22/57 (39%)
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 1 1.010 - - QHG54126
OrthoDB 1 1.010 - - D1330600at2759
OrthoFinder 1 1.000 - - FOG0000697
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 1 0.900 - - OOG6_100410
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 1 1.000 - - X1327
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
ZFIN 00.000 Not matched by this tool.
65.830

Return to query results.
Submit another query.