DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment Alg-2 and capn9

DIOPT Version :9

Sequence 1:NP_001104459.2 Gene:Alg-2 / 3355106 FlyBaseID:FBgn0086378 Length:178 Species:Drosophila melanogaster
Sequence 2:NP_001003501.1 Gene:capn9 / 445107 ZFINID:ZDB-GENE-010724-2 Length:688 Species:Danio rerio


Alignment Length:156 Identity:44/156 - (28%)
Similarity:77/156 - (49%) Gaps:10/156 - (6%)


- Green bases have known domain annotations that are detailed below.


  Fly    29 ISADELQVALSN-------GTWSAFNPETIRLMIGMFDRENKGTVSFKDFGALWKYVTDWQNCFR 86
            |||.|||..|:|       ..:...:..|...:|.:.|.:..|.:.|.:|...|..:..|...|.
Zfish   535 ISARELQHVLNNVLGRRKEVKFDGLSLNTCISIINLMDVDGSGMMEFSEFKVFWDKLKKWIMLFL 599

  Fly    87 SFDRDNSGNIDKTELKTALTSFGYRLSDHLIDVL-LRKFDRFGRGTILFDDFIQCCIVLYTLTTA 150
            |:|.|.||.:...||::||.:.|.:|::.::.:| ||..|.  :..|.|||::.|.:.|..:...
Zfish   600 SYDVDRSGTMSSYELRSALNAAGMKLNNRILQLLGLRFADE--KLEIDFDDYLTCIVRLENMFRI 662

  Fly   151 FRQHDTDLDGIITIHYEQFLSMVFSL 176
            |:..|....|.::::..|||.:..::
Zfish   663 FQALDAQKKGEVSLNMHQFLLLTMNV 688

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
Alg-2NP_001104459.2 EF-hand_7 16..71 CDD:290234 13/48 (27%)
EFh 16..71 CDD:238008 13/48 (27%)
EF-hand_7 82..139 CDD:290234 20/57 (35%)
EFh 85..139 CDD:238008 20/54 (37%)
capn9NP_001003501.1 Peptidase_C2 41..333 CDD:279042
Calpain_III 347..489 CDD:279416
EFh 564..618 CDD:298682 15/53 (28%)
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
ZFIN 00.000 Not matched by this tool.
10.910

Return to query results.
Submit another query.