DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment Alg-2 and capn1

DIOPT Version :9

Sequence 1:NP_001104459.2 Gene:Alg-2 / 3355106 FlyBaseID:FBgn0086378 Length:178 Species:Drosophila melanogaster
Sequence 2:NP_998624.1 Gene:capn1 / 406768 ZFINID:ZDB-GENE-040426-2814 Length:704 Species:Danio rerio


Alignment Length:180 Identity:48/180 - (26%)
Similarity:94/180 - (52%) Gaps:16/180 - (8%)


- Green bases have known domain annotations that are detailed below.


  Fly     8 MPDQQFLWDV-----FQRVDKDRSG---HISADELQVALS-------NGTWSAFNPETIRLMIGM 57
            :|::|.|.:.     |:.:.:..:|   .||..|||..|:       :.....|..|:.|.||.:
Zfish   522 IPEEQRLDESQIDAGFKSLFRQLAGADMEISVTELQTILNRIIAKHKDLKTDGFGKESCRSMINL 586

  Fly    58 FDRENKGTVSFKDFGALWKYVTDWQNCFRSFDRDNSGNIDKTELKTALTSFGYRLSDHLIDVLLR 122
            .|.:..|.:...:|..||:.:..:...||..|.|.||.:...|::.||.:.|::|::||..:::.
Zfish   587 VDTDGSGKLGLVEFHVLWEKIKRYLQIFRDHDVDKSGTMSSYEMRKALETAGFKLNNHLFQLIIL 651

  Fly   123 KFDRFGRGTILFDDFIQCCIVLYTLTTAFRQHDTDLDGIITIHYEQFLSM 172
            ::..... ::.||:|:.|.:.|.|:...|:..|||.||:|::.:.|::::
Zfish   652 RYTEEDL-SVDFDNFVSCLVRLETMFKTFKSLDTDADGVISLTFFQWITL 700

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
Alg-2NP_001104459.2 EF-hand_7 16..71 CDD:290234 15/69 (22%)
EFh 16..71 CDD:238008 15/69 (22%)
EF-hand_7 82..139 CDD:290234 16/56 (29%)
EFh 85..139 CDD:238008 16/53 (30%)
capn1NP_998624.1 Peptidase_C2 51..347 CDD:279042
Calpain_III 361..509 CDD:279416
EF-hand_8 547..606 CDD:290545 16/58 (28%)
EFh 580..634 CDD:238008 15/53 (28%)
EF-hand_7 612..698 CDD:290234 27/86 (31%)
EFh 613..692 CDD:298682 26/79 (33%)
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 1 1.000 - -
TreeFam 00.000 Not matched by this tool.
ZFIN 00.000 Not matched by this tool.
21.910

Return to query results.
Submit another query.