DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment Alg-2 and pdcd6

DIOPT Version :9

Sequence 1:NP_001104459.2 Gene:Alg-2 / 3355106 FlyBaseID:FBgn0086378 Length:178 Species:Drosophila melanogaster
Sequence 2:NP_957244.1 Gene:pdcd6 / 393925 ZFINID:ZDB-GENE-040426-1307 Length:185 Species:Danio rerio


Alignment Length:184 Identity:116/184 - (63%)
Similarity:138/184 - (75%) Gaps:8/184 - (4%)


- Green bases have known domain annotations that are detailed below.


  Fly     1 MAYN--------HDGMPDQQFLWDVFQRVDKDRSGHISADELQVALSNGTWSAFNPETIRLMIGM 57
            |||:        :...|||.|||::||||||||||.||..|||.|||||||:.|||.|:|.:|.|
Zfish     1 MAYHNQYRPPHYNSAPPDQGFLWNIFQRVDKDRSGAISDTELQQALSNGTWTPFNPVTVRSIISM 65

  Fly    58 FDRENKGTVSFKDFGALWKYVTDWQNCFRSFDRDNSGNIDKTELKTALTSFGYRLSDHLIDVLLR 122
            |||||||.|:|.:|..:|||:|||||.||::||||||.|||.|||.|||.|||||||...:.|:.
Zfish    66 FDRENKGGVNFNEFAGVWKYITDWQNIFRTYDRDNSGFIDKNELKQALTGFGYRLSDQFYNTLIE 130

  Fly   123 KFDRFGRGTILFDDFIQCCIVLYTLTTAFRQHDTDLDGIITIHYEQFLSMVFSL 176
            ||||..||.:.|||||||||||..||..||::|||.||.|.:.|||:|||||::
Zfish   131 KFDRQKRGQVAFDDFIQCCIVLQRLTDVFRRYDTDQDGWIQVSYEQYLSMVFNV 184

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
Alg-2NP_001104459.2 EF-hand_7 16..71 CDD:290234 38/54 (70%)
EFh 16..71 CDD:238008 38/54 (70%)
EF-hand_7 82..139 CDD:290234 37/56 (66%)
EFh 85..139 CDD:238008 35/53 (66%)
pdcd6NP_957244.1 EF-hand_7 24..80 CDD:290234 38/55 (69%)
EFh 25..80 CDD:238008 38/54 (70%)
EFh 59..114 CDD:238008 36/54 (67%)
EF-hand_7 90..147 CDD:290234 37/56 (66%)
EFh 92..147 CDD:238008 35/54 (65%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 1 0.930 - - C170587276
Domainoid 1 1.000 87 1.000 Domainoid score I8006
eggNOG 00.000 Not matched by this tool.
Hieranoid 1 1.000 - -
Homologene 1 1.000 - - H7880
Inparanoid 1 1.050 242 1.000 Inparanoid score I3305
OMA 1 1.010 - - QHG54126
OrthoDB 1 1.010 - - D1330600at2759
OrthoFinder 1 1.000 - - FOG0000697
OrthoInspector 1 1.000 - - oto39310
orthoMCL 1 0.900 - - OOG6_100410
Panther 1 1.100 - - LDO PTHR46212
Phylome 1 0.910 - -
RoundUp 1 1.030 - avgDist Average_Evolutionary_Distance R4200
SonicParanoid 1 1.000 - - X1327
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
ZFIN 00.000 Not matched by this tool.
1413.940

Return to query results.
Submit another query.