DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment Alg-2 and CalpB

DIOPT Version :9

Sequence 1:NP_001104459.2 Gene:Alg-2 / 3355106 FlyBaseID:FBgn0086378 Length:178 Species:Drosophila melanogaster
Sequence 2:NP_001246706.1 Gene:CalpB / 39165 FlyBaseID:FBgn0025866 Length:925 Species:Drosophila melanogaster


Alignment Length:150 Identity:49/150 - (32%)
Similarity:80/150 - (53%) Gaps:15/150 - (10%)


- Green bases have known domain annotations that are detailed below.


  Fly    10 DQQFLWDVFQRVDKDRSGHISADELQVALSNGTWSAFNPETIRLMIGMFDRENKGTVSFKDFGAL 74
            |::..|...:|:    ..| |..::.|. |:|    |:.:.:|.|:.|.|::..|.:.|::|.||
  Fly   770 DEEVDWQELKRI----LDH-SMRDVMVG-SDG----FSKDAVRSMVAMLDKDRSGRLGFEEFEAL 824

  Fly    75 WKYVTDWQNCFRSFDRDNSGNIDKTELKTALTSFGYRLSDHLIDVLLRKFDRFG--RGTILFDDF 137
            ...:..|:..|:.:|...:|:||...|:.||.|.||.|::.|::.|..   |:|  .|.|.||||
  Fly   825 LTDIAKWRAVFKLYDTRRTGSIDGFHLRGALNSAGYHLNNRLLNALAH---RYGSREGQIPFDDF 886

  Fly   138 IQCCIVLYTLTTAFRQHDTD 157
            :.|.|.:.|....||:.|||
  Fly   887 LMCAIKVRTFIEMFRERDTD 906

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
Alg-2NP_001104459.2 EF-hand_7 16..71 CDD:290234 13/54 (24%)
EFh 16..71 CDD:238008 13/54 (24%)
EF-hand_7 82..139 CDD:290234 22/58 (38%)
EFh 85..139 CDD:238008 22/55 (40%)
CalpBNP_001246706.1 PD-C2-AF1 33..225 CDD:286403
Drf_FH1 37..189 CDD:283903
Peptidase_C2 260..556 CDD:279042
Calpain_III 574..721 CDD:279416
EF-hand_7 759..825 CDD:290234 17/64 (27%)
EFh 761..826 CDD:298682 18/65 (28%)
FRQ1 827..>908 CDD:227455 30/82 (37%)
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 1 0.930 - - C45448314
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
21.840

Return to query results.
Submit another query.