DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment Alg-2 and Capn13

DIOPT Version :9

Sequence 1:NP_001104459.2 Gene:Alg-2 / 3355106 FlyBaseID:FBgn0086378 Length:178 Species:Drosophila melanogaster
Sequence 2:NP_001028616.1 Gene:Capn13 / 381122 MGIID:2685789 Length:665 Species:Mus musculus


Alignment Length:162 Identity:39/162 - (24%)
Similarity:69/162 - (42%) Gaps:13/162 - (8%)


- Green bases have known domain annotations that are detailed below.


  Fly    24 DRSGHISADELQVA-----LSNGTWSAFNPETIRLMIGMFDRENKGTVSFKDFGALWKYVTDWQN 83
            |:...|.|.:||..     |:......|:.:..:.::.:.|.:..|.:..::|..|...:...|:
Mouse   507 DQGLDIDATQLQSLLNQEFLTGPPGDTFSLDQCQSIMALMDLKVNGRLDQEEFARLRSRLIHCQH 571

  Fly    84 CFRSFDRDNSGNIDKTELKTAL--TSF--GYRLSDHLIDVL-LRKFDRFGRGTILFDDFIQCCIV 143
            .|:|..| ..|.:..::|...:  |.|  |..:|..|:.:: ||..|..||  :.|...:...|.
Mouse   572 IFQSIQR-RPGVLLSSDLWKVIENTDFLVGIFISSELLSLMALRYSDSSGR--VSFPTLVCFLIR 633

  Fly   144 LYTLTTAFRQHDTDLDGIITIHYEQFLSMVFS 175
            |.|:..|||....|..||.....|....:::|
Mouse   634 LETMAKAFRNLSKDGKGIYLTETEWMNLVMYS 665

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
Alg-2NP_001104459.2 EF-hand_7 16..71 CDD:290234 9/51 (18%)
EFh 16..71 CDD:238008 9/51 (18%)
EF-hand_7 82..139 CDD:290234 17/61 (28%)
EFh 85..139 CDD:238008 16/58 (28%)
Capn13NP_001028616.1 Peptidase_C2 31..327 CDD:279042
Calpain_III 343..469 CDD:294111
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
10.910

Return to query results.
Submit another query.