DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment Alg-2 and CalpA

DIOPT Version :9

Sequence 1:NP_001104459.2 Gene:Alg-2 / 3355106 FlyBaseID:FBgn0086378 Length:178 Species:Drosophila melanogaster
Sequence 2:NP_001286613.1 Gene:CalpA / 37232 FlyBaseID:FBgn0012051 Length:843 Species:Drosophila melanogaster


Alignment Length:169 Identity:49/169 - (28%)
Similarity:88/169 - (52%) Gaps:18/169 - (10%)


- Green bases have known domain annotations that are detailed below.


  Fly     7 GMPDQQFLWDVFQRVDKDR---SGHISADELQVALSNGTWSAFNPETIRLMIGMFDRENKGTVSF 68
            ||.||.     .:|:..|.   .|.::|:.: |..::|    |:.:..|.|:.|.|.:..|.:.|
  Fly   682 GMNDQS-----NKRLIGDNPADGGPVTANAI-VDETHG----FSKDVCRSMVAMLDADKSGKLGF 736

  Fly    69 KDFGALWKYVTDWQNCFRSFDRDNSGNIDKTELKTALTSFGYRLSDHLIDVLLRKFDRFGR--GT 131
            ::|..|...:..|:..|:.:|.:|:|.:...:|:.||.|.||.|::.:::||   ..|:|.  |.
  Fly   737 EEFETLLSEIAKWKAIFKVYDVENTGRVSGFQLREALNSAGYHLNNRVLNVL---GHRYGSRDGK 798

  Fly   132 ILFDDFIQCCIVLYTLTTAFRQHDTDLDGIITIHYEQFL 170
            |.|||||.|.:.:.|....|::.||:.:...|...|:::
  Fly   799 IAFDDFIMCAVKIKTYIDIFKERDTEKNETATFTLEEWI 837

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
Alg-2NP_001104459.2 EF-hand_7 16..71 CDD:290234 13/57 (23%)
EFh 16..71 CDD:238008 13/57 (23%)
EF-hand_7 82..139 CDD:290234 21/58 (36%)
EFh 85..139 CDD:238008 21/55 (38%)
CalpANP_001286613.1 Peptidase_C2 104..400 CDD:279042
Calpain_III 418..565 CDD:279416
EFh 719..765 CDD:238008 13/45 (29%)
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 1 0.930 - - C45448311
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
21.840

Return to query results.
Submit another query.