DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment Alg-2 and CG17765

DIOPT Version :9

Sequence 1:NP_001104459.2 Gene:Alg-2 / 3355106 FlyBaseID:FBgn0086378 Length:178 Species:Drosophila melanogaster
Sequence 2:NP_610592.1 Gene:CG17765 / 36111 FlyBaseID:FBgn0033529 Length:199 Species:Drosophila melanogaster


Alignment Length:158 Identity:66/158 - (41%)
Similarity:94/158 - (59%) Gaps:2/158 - (1%)


- Green bases have known domain annotations that are detailed below.


  Fly    15 WDVFQRVDKDRSGHISADELQVALSNGTWSAFNPETIRLMIGMFDRENKGTVSFKDFGALWKYVT 79
            |  |..||:||||.|:|.|||.||.||....|:....:|||.|||.:..||:...:|..|:.|:.
  Fly    38 W--FSMVDRDRSGKINASELQAALVNGRGDHFSDNACKLMISMFDNDASGTIDIYEFEKLYNYIN 100

  Fly    80 DWQNCFRSFDRDNSGNIDKTELKTALTSFGYRLSDHLIDVLLRKFDRFGRGTILFDDFIQCCIVL 144
            .|...|:::|:|:||:|::.||..|.|..|:|.|...|:.|::|.|..|...:..|.||..|:.:
  Fly   101 QWLQVFKTYDQDSSGHIEEQELTQAFTQMGFRFSPEFINFLVKKSDPQGHKEVSVDQFIVLCVQV 165

  Fly   145 YTLTTAFRQHDTDLDGIITIHYEQFLSM 172
            ...|.||||.||..:|.|||.:|.||::
  Fly   166 QRFTEAFRQRDTQQNGTITIGFEDFLTV 193

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
Alg-2NP_001104459.2 EF-hand_7 16..71 CDD:290234 25/54 (46%)
EFh 16..71 CDD:238008 25/54 (46%)
EF-hand_7 82..139 CDD:290234 20/56 (36%)
EFh 85..139 CDD:238008 20/53 (38%)
CG17765NP_610592.1 FRQ1 26..162 CDD:227455 51/125 (41%)
EFh 39..92 CDD:238008 25/52 (48%)
EFh 105..159 CDD:298682 19/53 (36%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 1 0.930 - - C45448318
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 1 1.050 86 1.000 Inparanoid score I2334
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 1 1.010 - - D1330600at2759
OrthoFinder 1 1.000 - - FOG0000697
OrthoInspector 1 1.000 - - mtm1073
orthoMCL 1 0.900 - - OOG6_100410
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 1 1.000 - - X1327
87.800

Return to query results.
Submit another query.