DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment Alg-2 and Capn1

DIOPT Version :9

Sequence 1:NP_001104459.2 Gene:Alg-2 / 3355106 FlyBaseID:FBgn0086378 Length:178 Species:Drosophila melanogaster
Sequence 2:NP_062025.1 Gene:Capn1 / 29153 RGDID:2267 Length:713 Species:Rattus norvegicus


Alignment Length:184 Identity:51/184 - (27%)
Similarity:94/184 - (51%) Gaps:24/184 - (13%)


- Green bases have known domain annotations that are detailed below.


  Fly     8 MPDQQFLW-----DVFQRVDKDRSG---HISADELQVAL-----------SNGTWSAFNPETIRL 53
            :||::.|.     |.|:.:....:|   .||..|||..|           :||    |:.|:.|.
  Rat   531 LPDEKVLSEEEIDDNFKTLFSKLAGDDMEISVKELQTILNRIISKHKDLRTNG----FSLESCRS 591

  Fly    54 MIGMFDRENKGTVSFKDFGALWKYVTDWQNCFRSFDRDNSGNIDKTELKTALTSFGYRLSDHLID 118
            |:.:.||:..|.:...:|..||..:.::...||.||.|.||::...|::.|:.:.|::|:..|.:
  Rat   592 MVNLMDRDGNGKLGLVEFNILWNRIRNYLTIFRKFDLDKSGSMSAYEMRMAIEAAGFKLNKKLHE 656

  Fly   119 VLLRKFDRFGRGTILFDDFIQCCIVLYTLTTAFRQHDTDLDGIITIHYEQFLSM 172
            :::.::..... .:.||:|:.|.:.|.|:...|:..||||||::|....::|.:
  Rat   657 LIITRYSEPDL-AVDFDNFVCCLVRLETMFRFFKILDTDLDGVVTFDLFKWLQL 709

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
Alg-2NP_001104459.2 EF-hand_7 16..71 CDD:290234 18/68 (26%)
EFh 16..71 CDD:238008 18/68 (26%)
EF-hand_7 82..139 CDD:290234 15/56 (27%)
EFh 85..139 CDD:238008 15/53 (28%)
Capn1NP_062025.1 Peptidase_C2 56..352 CDD:279042
Domain III 355..525
Calpain_III 366..518 CDD:279416
Linker 526..541 3/9 (33%)
PTZ00184 537..680 CDD:185504 38/147 (26%)
Domain IV 542..712 48/173 (28%)
EF-hand_8 556..609 CDD:290545 15/56 (27%)
EFh 589..643 CDD:238008 16/53 (30%)
EFh 622..704 CDD:298682 26/82 (32%)
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 1 1.000 - -
TreeFam 00.000 Not matched by this tool.
21.910

Return to query results.
Submit another query.