DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment Alg-2 and GCA

DIOPT Version :9

Sequence 1:NP_001104459.2 Gene:Alg-2 / 3355106 FlyBaseID:FBgn0086378 Length:178 Species:Drosophila melanogaster
Sequence 2:XP_006712461.1 Gene:GCA / 25801 HGNCID:15990 Length:259 Species:Homo sapiens


Alignment Length:158 Identity:56/158 - (35%)
Similarity:88/158 - (55%) Gaps:17/158 - (10%)


- Green bases have known domain annotations that are detailed below.


  Fly    25 RSGHISADELQVALS----NGTWSAFNPETIRLMIGMFDRENKGTVSFKDFGALWKYVTDWQNCF 85
            :.|.:.|:|||..|:    |||:|.|:.||.|:||.|.||::.|.:.|..|..||..:..|:..|
Human    90 QDGEVDAEELQRCLTQSGINGTYSPFSLETCRIMIAMLDRDHTGKMGFNAFKELWAALNAWKENF 154

  Fly    86 RSFDRDNSGNIDKTELKTALTSFGYRLSDHLIDVLLRKFDRFGRGTILFDDFIQCCIVLYTLTTA 150
            .:.|:|.||.::..||:.|:...|||||...:..:::::.:.||  |.|||::.||:.|..||..
Human   155 MTVDQDGSGTVEHHELRQAIGLMGYRLSPQTLTTIVKRYSKNGR--IFFDDYVACCVKLRALTDF 217

  Fly   151 FRQHD-----------TDLDGIITIHYE 167
            ||:.|           .|..|:..|::|
Human   218 FRKRDHLQQGSANFIYDDCGGMNVINFE 245

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
Alg-2NP_001104459.2 EF-hand_7 16..71 CDD:290234 21/49 (43%)
EFh 16..71 CDD:238008 21/49 (43%)
EF-hand_7 82..139 CDD:290234 19/56 (34%)
EFh 85..139 CDD:238008 19/53 (36%)
GCAXP_006712461.1 EFh 90..145 CDD:298682 23/54 (43%)
EFh 120..174 CDD:298682 19/53 (36%)
EF-hand_7 151..206 CDD:290234 19/56 (34%)
EFh 151..206 CDD:298682 19/56 (34%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 1 1.010 - - QHG54126
OrthoDB 1 1.010 - - D1330600at2759
OrthoFinder 1 1.000 - - FOG0000697
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 1 0.900 - - OOG6_100410
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
User_Submission 00.000 Not matched by this tool.
54.830

Return to query results.
Submit another query.