DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment Alg-2 and Gca

DIOPT Version :9

Sequence 1:NP_001104459.2 Gene:Alg-2 / 3355106 FlyBaseID:FBgn0086378 Length:178 Species:Drosophila melanogaster
Sequence 2:NP_663498.1 Gene:Gca / 227960 MGIID:1918521 Length:220 Species:Mus musculus


Alignment Length:174 Identity:62/174 - (35%)
Similarity:95/174 - (54%) Gaps:7/174 - (4%)


- Green bases have known domain annotations that are detailed below.


  Fly     1 MAYNHDGMPDQQFLWDVFQRVDKDRSGHISADELQVALS----NGTWSAFNPETIRLMIGMFDRE 61
            :.|:....|....:|..|..| ..:.|.:.|:|||..|:    :||::.|:.||.|:||.|.||:
Mouse    44 LGYSDSYSPADDSMWTYFTAV-AGQDGEVDAEELQRCLTQSGISGTYAPFSLETCRIMIAMLDRD 107

  Fly    62 NKGTVSFKDFGALWKYVTDWQNCFRSFDRDNSGNIDKTELKTALTSFGYRLSDHLIDVLLRKFDR 126
            ..|.:.|.:|..||..:..|:..|.:.|:|.||.::..||..|:...|||||...:..::|::.:
Mouse   108 YTGKMGFNEFKELWAALNAWKQNFMTIDQDQSGTVEHHELSQAIALMGYRLSPQTLAAIVRRYSK 172

  Fly   127 FGRGTILFDDFIQCCIVLYTLTTAFRQHDTDLDGIITIHYEQFL 170
            .||  |.|||::.||:.|..||..||:.|....||:...||.||
Mouse   173 NGR--IFFDDYVACCVKLRALTDFFRRRDHLQQGIVNFMYEDFL 214

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
Alg-2NP_001104459.2 EF-hand_7 16..71 CDD:290234 21/58 (36%)
EFh 16..71 CDD:238008 21/58 (36%)
EF-hand_7 82..139 CDD:290234 20/56 (36%)
EFh 85..139 CDD:238008 20/53 (38%)
GcaNP_663498.1 EFh 67..122 CDD:238008 21/54 (39%)
EF-hand_7 67..120 CDD:290234 20/52 (38%)
EFh 97..152 CDD:298682 20/54 (37%)
EF-hand_7 128..183 CDD:290234 20/56 (36%)
EFh 131..183 CDD:298682 20/53 (38%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 1 1.010 - - QHG54126
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 1 1.000 - - FOG0000697
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 1 0.900 - - OOG6_100410
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
43.820

Return to query results.
Submit another query.