DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment Alg-2 and Pdcd6

DIOPT Version :9

Sequence 1:NP_001104459.2 Gene:Alg-2 / 3355106 FlyBaseID:FBgn0086378 Length:178 Species:Drosophila melanogaster
Sequence 2:NP_035181.1 Gene:Pdcd6 / 18570 MGIID:109283 Length:191 Species:Mus musculus


Alignment Length:169 Identity:116/169 - (68%)
Similarity:136/169 - (80%) Gaps:0/169 - (0%)


- Green bases have known domain annotations that are detailed below.


  Fly     8 MPDQQFLWDVFQRVDKDRSGHISADELQVALSNGTWSAFNPETIRLMIGMFDRENKGTVSFKDFG 72
            :|||.|||:|||||||||||.||.:|||.|||||||:.|||.|:|.:|.|||||||..|:|.:|.
Mouse    22 LPDQSFLWNVFQRVDKDRSGVISDNELQQALSNGTWTPFNPVTVRSIISMFDRENKAGVNFSEFT 86

  Fly    73 ALWKYVTDWQNCFRSFDRDNSGNIDKTELKTALTSFGYRLSDHLIDVLLRKFDRFGRGTILFDDF 137
            .:|||:|||||.||::||||||.|||.|||.||:.|||||||...|:|:|||||.|||.|.||||
Mouse    87 GVWKYITDWQNVFRTYDRDNSGMIDKNELKQALSGFGYRLSDQFHDILIRKFDRQGRGQIAFDDF 151

  Fly   138 IQCCIVLYTLTTAFRQHDTDLDGIITIHYEQFLSMVFSL 176
            ||.||||..||..||::|||.||.|.:.|||:||||||:
Mouse   152 IQGCIVLQRLTDIFRRYDTDQDGWIQVSYEQYLSMVFSI 190

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
Alg-2NP_001104459.2 EF-hand_7 16..71 CDD:290234 38/54 (70%)
EFh 16..71 CDD:238008 38/54 (70%)
EF-hand_7 82..139 CDD:290234 40/56 (71%)
EFh 85..139 CDD:238008 38/53 (72%)
Pdcd6NP_035181.1 EFh_PEF_ALG-2 27..191 CDD:320058 113/164 (69%)
EF-hand motif 27..56 CDD:320058 23/28 (82%)
EF-hand motif 64..93 CDD:320058 16/28 (57%)
EF-hand motif 94..123 CDD:320058 20/28 (71%)
EF-hand motif 130..159 CDD:320058 20/28 (71%)
EF-hand motif 161..189 CDD:320058 17/27 (63%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 1 0.930 - - C167842828
Domainoid 1 1.000 93 1.000 Domainoid score I7554
eggNOG 00.000 Not matched by this tool.
Hieranoid 1 1.000 - -
Homologene 1 1.000 - - H7880
Inparanoid 1 1.050 245 1.000 Inparanoid score I3270
Isobase 1 0.950 - 0 Normalized mean entropy S1635
OMA 1 1.010 - - QHG54126
OrthoDB 1 1.010 - - D1330600at2759
OrthoFinder 1 1.000 - - FOG0000697
OrthoInspector 1 1.000 - - oto95324
orthoMCL 1 0.900 - - OOG6_100410
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
RoundUp 1 1.030 - avgDist Average_Evolutionary_Distance R4200
SonicParanoid 1 1.000 - - X1327
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
1413.790

Return to query results.
Submit another query.