DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment Alg-2 and Capn8

DIOPT Version :9

Sequence 1:NP_001104459.2 Gene:Alg-2 / 3355106 FlyBaseID:FBgn0086378 Length:178 Species:Drosophila melanogaster
Sequence 2:NP_570960.2 Gene:Capn8 / 170725 MGIID:2181366 Length:703 Species:Mus musculus


Alignment Length:176 Identity:52/176 - (29%)
Similarity:84/176 - (47%) Gaps:19/176 - (10%)


- Green bases have known domain annotations that are detailed below.


  Fly     6 DGMPDQQFLWDVFQR-VDKDRSGHISADELQVALSNGTWS--------AFNPETIRLMIGMFDRE 61
            || .|:.| |.:.:. .|||  ..|||.:|:..| ||..|        .||..|.|.||.:.|.:
Mouse   531 DG-EDEHF-WSLSEEFADKD--SEISAHQLKRVL-NGLLSKRTDMKFDGFNINTCREMISLLDGD 590

  Fly    62 NKGTVSFKDFGALWKYVTDWQNCFRSFDRDNSGNIDKTELKTALTSFGYRLSDHLIDVLLRKF-- 124
            ..|::...:|..||..:..:...::..|...:|.||..|::|||...|:.|::.:...:..::  
Mouse   591 GTGSLRPVEFKTLWLKICKYLEIYQEMDHSRAGTIDAHEMRTALKKAGFTLNNQVQQTIATRYAC 655

  Fly   125 DRFGRGTILFDDFIQCCIVLYTLTTAFRQHDTDLDGIITIHYEQFL 170
            .:.|   :.||.|:.|.|.|..|...||..|.|.:||:.:...::|
Mouse   656 SKLG---VDFDGFVACMIRLEILFKLFRLLDKDQNGIVQLSLAEWL 698

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
Alg-2NP_001104459.2 EF-hand_7 16..71 CDD:290234 19/63 (30%)
EFh 16..71 CDD:238008 19/63 (30%)
EF-hand_7 82..139 CDD:290234 14/58 (24%)
EFh 85..139 CDD:238008 14/55 (25%)
Capn8NP_570960.2 Peptidase_C2 46..342 CDD:279042
Domain III 355..512
Calpain_III 356..509 CDD:279416
Linker. /evidence=ECO:0000250 513..531 52/176 (30%)
Domain IV. /evidence=ECO:0000250 532..703 51/175 (29%)
EFh 580..635 CDD:298682 15/54 (28%)
PTZ00183 611..>692 CDD:185503 24/83 (29%)
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
10.910

Return to query results.
Submit another query.