DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment Alg-2 and Capns1

DIOPT Version :9

Sequence 1:NP_001104459.2 Gene:Alg-2 / 3355106 FlyBaseID:FBgn0086378 Length:178 Species:Drosophila melanogaster
Sequence 2:NP_033925.2 Gene:Capns1 / 12336 MGIID:88266 Length:268 Species:Mus musculus


Alignment Length:152 Identity:45/152 - (29%)
Similarity:78/152 - (51%) Gaps:10/152 - (6%)


- Green bases have known domain annotations that are detailed below.


  Fly    29 ISADELQVALSNGT-------WSAFNPETIRLMIGMFDRENKGTVSFKDFGALWKYVTDWQNCFR 86
            :||.||...|:...       ...|..:|.|.|:.:.|.:..|.:.|::|..||..:..||..::
Mouse   115 VSATELMNILNKVVTRHPDLKTDGFGIDTCRSMVAVMDSDTTGKLGFEEFKYLWNNIKKWQAIYK 179

  Fly    87 SFDRDNSGNIDKTELKTALTSFGYRLSDHLIDVLLRKF-DRFGRGTILFDDFIQCCIVLYTLTTA 150
            .||.|.||.|...||..|..:.|:.|::||..:::|:: |.  .|.:.||:||.|.:.|..:..|
Mouse   180 RFDTDRSGTIGSHELPGAFEAAGFHLNEHLYSMIIRRYADE--SGNMDFDNFISCLVRLDAMFRA 242

  Fly   151 FRQHDTDLDGIITIHYEQFLSM 172
            |:..|.:..|.|.::.:::|.:
Mouse   243 FKSLDKNGTGQIQVNIQEWLQL 264

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
Alg-2NP_001104459.2 EF-hand_7 16..71 CDD:290234 12/48 (25%)
EFh 16..71 CDD:238008 12/48 (25%)
EF-hand_7 82..139 CDD:290234 20/57 (35%)
EFh 85..139 CDD:238008 19/54 (35%)
Capns1NP_033925.2 EFh_PEF_CPNS1_2 100..268 CDD:320063 45/152 (30%)
EF-hand motif 100..128 CDD:320063 5/12 (42%)
EF-hand motif 142..172 CDD:320063 9/29 (31%)
EF-hand motif 173..203 CDD:320063 11/29 (38%)
EF-hand motif 209..237 CDD:320063 9/29 (31%)
EF-hand motif 238..268 CDD:320063 6/27 (22%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 1 1.010 - - D1330600at2759
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
21.920

Return to query results.
Submit another query.