DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment Alg-2 and Capn2

DIOPT Version :9

Sequence 1:NP_001104459.2 Gene:Alg-2 / 3355106 FlyBaseID:FBgn0086378 Length:178 Species:Drosophila melanogaster
Sequence 2:NP_033924.2 Gene:Capn2 / 12334 MGIID:88264 Length:700 Species:Mus musculus


Alignment Length:177 Identity:56/177 - (31%)
Similarity:89/177 - (50%) Gaps:25/177 - (14%)


- Green bases have known domain annotations that are detailed below.


  Fly    16 DVFQRVDKDRSG---HISADELQVAL-----------SNGTWSAFNPETIRLMIGMFDRENKGTV 66
            |.|:|:....:|   .|||.|||..|           |:|    |:.||.::|:.|.|.:..|.:
Mouse   532 DGFRRLFVQLAGEDAEISAFELQTILRRVLAKRQDIKSDG----FSIETCKIMVDMLDEDGSGKL 592

  Fly    67 SFKDFGALWKYVTDWQNCFRSFDRDNSGNIDKTELKTALTSFGYRLSDHLIDVLLRKF--DRFGR 129
            ..|:|..||..:..:|..:|..|.|.||.::..|::.||...|::|...|..|::.:|  |..  
Mouse   593 GLKEFYILWTKIQKYQKIYREIDVDRSGTMNSYEMRKALEEAGFKLPCQLHQVIVARFADDEL-- 655

  Fly   130 GTILFDDFIQCCIVLYTLTTAFRQHDTDLDGIITIHYEQFLSMVFSL 176
             .|.||:|::|.:.|.||...|:|.|.:..|.|.::...:||  ||:
Mouse   656 -IIDFDNFVRCLVRLETLFKIFKQLDPENTGTIQLNLASWLS--FSV 699

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
Alg-2NP_001104459.2 EF-hand_7 16..71 CDD:290234 21/68 (31%)
EFh 16..71 CDD:238008 21/68 (31%)
EF-hand_7 82..139 CDD:290234 19/58 (33%)
EFh 85..139 CDD:238008 18/55 (33%)
Capn2NP_033924.2 Peptidase_C2 46..342 CDD:279042
Domain III 345..514
Calpain_III 356..507 CDD:279416
Linker 515..529
Domain IV 530..700 56/177 (32%)
EFh 577..631 CDD:238008 15/53 (28%)
FRQ1 604..>690 CDD:227455 28/88 (32%)
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 1 1.000 - -
TreeFam 00.000 Not matched by this tool.
21.910

Return to query results.
Submit another query.