DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment Alg-2 and Sri

DIOPT Version :9

Sequence 1:NP_001104459.2 Gene:Alg-2 / 3355106 FlyBaseID:FBgn0086378 Length:178 Species:Drosophila melanogaster
Sequence 2:NP_001074443.1 Gene:Sri / 109552 MGIID:98419 Length:198 Species:Mus musculus


Alignment Length:170 Identity:65/170 - (38%)
Similarity:97/170 - (57%) Gaps:7/170 - (4%)


- Green bases have known domain annotations that are detailed below.


  Fly    11 QQFLWDVFQRVDKDRSGHISADELQVALSN----GTWSAFNPETIRLMIGMFDRENKGTVSFKDF 71
            |..|:..|..| ..:.|.|.|||||..|:.    |.:..||.||.|||:.|.||:..||:.|.:|
Mouse    32 QDPLYGYFAAV-AGQDGQIDADELQRCLTQSGIAGGYKPFNLETCRLMVSMLDRDMSGTMGFNEF 95

  Fly    72 GALWKYVTDWQNCFRSFDRDNSGNIDKTELKTALTSFGYRLSDHLIDVLLRKFDRFGRGTILFDD 136
            ..||..:..|:..|.|||.|.||.:|..||:.|||:.|:|||...::.:.:::...|:  |.|||
Mouse    96 KELWAVLNGWRQHFISFDSDRSGTVDPQELQKALTTMGFRLSPQTVNSVAKRYSTSGK--ITFDD 158

  Fly   137 FIQCCIVLYTLTTAFRQHDTDLDGIITIHYEQFLSMVFSL 176
            :|.||:.|..||.:||:.|:...|::...|:.|:..|.::
Mouse   159 YIACCVKLRALTDSFRRRDSGQQGVVNFSYDDFIQCVMTV 198

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
Alg-2NP_001104459.2 EF-hand_7 16..71 CDD:290234 24/58 (41%)
EFh 16..71 CDD:238008 24/58 (41%)
EF-hand_7 82..139 CDD:290234 22/56 (39%)
EFh 85..139 CDD:238008 22/53 (42%)
SriNP_001074443.1 EFh_PEF_sorcin 34..198 CDD:320062 64/166 (39%)
EF-hand motif 34..62 CDD:320062 11/28 (39%)
EF-hand motif 74..103 CDD:320062 13/28 (46%)
EF-hand motif 104..134 CDD:320062 14/29 (48%)
EF-hand motif 140..167 CDD:320062 8/28 (29%)
EF-hand motif 168..198 CDD:320062 9/29 (31%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 1 1.010 - - QHG54126
OrthoDB 1 1.010 - - D1330600at2759
OrthoFinder 1 1.000 - - FOG0000697
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 1 0.900 - - OOG6_100410
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 1 1.000 - -
TreeFam 00.000 Not matched by this tool.
65.830

Return to query results.
Submit another query.