DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment Alg-2 and capn10l

DIOPT Version :9

Sequence 1:NP_001104459.2 Gene:Alg-2 / 3355106 FlyBaseID:FBgn0086378 Length:178 Species:Drosophila melanogaster
Sequence 2:XP_031758129.1 Gene:capn10l / 100497805 XenbaseID:XB-GENE-5889689 Length:708 Species:Xenopus tropicalis


Alignment Length:186 Identity:43/186 - (23%)
Similarity:76/186 - (40%) Gaps:39/186 - (20%)


- Green bases have known domain annotations that are detailed below.


  Fly     3 YNHDGMPDQQFLWDVFQRVD---------------------------KDRSGHISADELQVALSN 40
            :|.|...:..||..||.|..                           ..:.|.:::.:||..|::
 Frog   502 FNADRSQESSFLLQVFLRSQGCTVELGDSQSFLKNEEKTQEETFMKYATQGGKMNSQDLQKFLND 566

  Fly    41 GTWSAFNP--------ETIRLMIGMFDRENKGTVSFKDFGALWKYVTDWQNCFRSFDRDNSGNID 97
            .....|.|        |..|.|:...|....|.:..:.|..||:|:..::..|...|.|.:|.|.
 Frog   567 VISKGFAPHGGIRFSTEASRSMLASMDFTCNGKLELEFFMRLWRYLNHFKAIFTDVDVDQNGFIG 631

  Fly    98 KTELKTALTSFGYRLSDHLIDVLLRKFDRFGRGTILFDDFIQCCIVLYTLTTAFRQ 153
            .:||:.|..|.|..:|...:.:||.::..: ...:.|:|:: ||:|  .|.:||::
 Frog   632 LSELRKAAKSAGMAVSSDQLTILLLRYGDY-EMKLNFEDYL-CCMV--RLKSAFKR 683

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
Alg-2NP_001104459.2 EF-hand_7 16..71 CDD:290234 14/89 (16%)
EFh 16..71 CDD:238008 14/89 (16%)
EF-hand_7 82..139 CDD:290234 15/56 (27%)
EFh 85..139 CDD:238008 15/53 (28%)
capn10lXP_031758129.1 Peptidase_C2 43..365 CDD:395523
Calpain_III 400..517 CDD:395848 4/14 (29%)
EFh_PEF_CAPN13_14 541..708 CDD:320070 36/147 (24%)
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
10.910

Return to query results.
Submit another query.