DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment Alg-2 and capn12

DIOPT Version :9

Sequence 1:NP_001104459.2 Gene:Alg-2 / 3355106 FlyBaseID:FBgn0086378 Length:178 Species:Drosophila melanogaster
Sequence 2:XP_031746547.1 Gene:capn12 / 100486294 XenbaseID:XB-GENE-1008507 Length:674 Species:Xenopus tropicalis


Alignment Length:157 Identity:39/157 - (24%)
Similarity:72/157 - (45%) Gaps:11/157 - (7%)


- Green bases have known domain annotations that are detailed below.


  Fly    24 DRSGHISADELQVALSNGTWSAFNP-------ETIRLMIGMFDRENKGTVSFKDFGALWKYVTDW 81
            |:.|.|:.:.|...|:: ....|:|       |:...:|...|...:|.:.::.|..|||.:...
 Frog   517 DQDGRITNEGLHHLLTS-LMKDFDPLLPEITMESCCRLIASLDTSAEGALCWEQFDRLWKNIITG 580

  Fly    82 QNCFRSFDRDNSGNIDKTELKTALTSFGYRLSDHLID-VLLRKFDRFGRGTILFDDFIQCCIVLY 145
            ...|.:.......|:||.::..||.|.|....:.|:. |.||..|:  .|::.:..||.|.:.:.
 Frog   581 SLIFSNLQSSKDRNLDKDQIGAALQSAGLITDNFLVRLVQLRYADK--DGSLSYSAFICCLLKIK 643

  Fly   146 TLTTAFRQHDTDLDGIITIHYEQFLSM 172
            .:|..|...|:...|.::::|.|:|.:
 Frog   644 AVTGMFEVADSTGSGTVSLNYHQWLQL 670

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
Alg-2NP_001104459.2 EF-hand_7 16..71 CDD:290234 11/53 (21%)
EFh 16..71 CDD:238008 11/53 (21%)
EF-hand_7 82..139 CDD:290234 15/57 (26%)
EFh 85..139 CDD:238008 15/54 (28%)
capn12XP_031746547.1 Peptidase_C2 33..327 CDD:395523
Calpain_III 350..476 CDD:395848
EFh_PEF 507..674 CDD:355382 39/157 (25%)
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
10.910

Return to query results.
Submit another query.