DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment Alg-2 and PDCD6

DIOPT Version :9

Sequence 1:NP_001104459.2 Gene:Alg-2 / 3355106 FlyBaseID:FBgn0086378 Length:178 Species:Drosophila melanogaster
Sequence 2:NP_037364.1 Gene:PDCD6 / 10016 HGNCID:8765 Length:191 Species:Homo sapiens


Alignment Length:169 Identity:116/169 - (68%)
Similarity:135/169 - (79%) Gaps:0/169 - (0%)


- Green bases have known domain annotations that are detailed below.


  Fly     8 MPDQQFLWDVFQRVDKDRSGHISADELQVALSNGTWSAFNPETIRLMIGMFDRENKGTVSFKDFG 72
            :|||.|||:|||||||||||.||..|||.|||||||:.|||.|:|.:|.|||||||..|:|.:|.
Human    22 LPDQSFLWNVFQRVDKDRSGVISDTELQQALSNGTWTPFNPVTVRSIISMFDRENKAGVNFSEFT 86

  Fly    73 ALWKYVTDWQNCFRSFDRDNSGNIDKTELKTALTSFGYRLSDHLIDVLLRKFDRFGRGTILFDDF 137
            .:|||:|||||.||::||||||.|||.|||.||:.|||||||...|:|:|||||.|||.|.||||
Human    87 GVWKYITDWQNVFRTYDRDNSGMIDKNELKQALSGFGYRLSDQFHDILIRKFDRQGRGQIAFDDF 151

  Fly   138 IQCCIVLYTLTTAFRQHDTDLDGIITIHYEQFLSMVFSL 176
            ||.||||..||..||::|||.||.|.:.|||:||||||:
Human   152 IQGCIVLQRLTDIFRRYDTDQDGWIQVSYEQYLSMVFSI 190

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
Alg-2NP_001104459.2 EF-hand_7 16..71 CDD:290234 38/54 (70%)
EFh 16..71 CDD:238008 38/54 (70%)
EF-hand_7 82..139 CDD:290234 40/56 (71%)
EFh 85..139 CDD:238008 38/53 (72%)
PDCD6NP_037364.1 EFh_PEF_ALG-2 27..191 CDD:320058 113/164 (69%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 1 0.930 - - C165152776
Domainoid 1 1.000 93 1.000 Domainoid score I7586
eggNOG 00.000 Not matched by this tool.
Hieranoid 1 1.000 - -
Homologene 1 1.000 - - H7880
Inparanoid 1 1.050 243 1.000 Inparanoid score I3311
Isobase 00.000 Not matched by this tool.
OMA 1 1.010 - - QHG54126
OrthoDB 1 1.010 - - D1330600at2759
OrthoFinder 1 1.000 - - FOG0000697
OrthoInspector 1 1.000 - - oto91744
orthoMCL 1 0.900 - - OOG6_100410
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
RoundUp 1 1.030 - avgDist Average_Evolutionary_Distance R4200
SonicParanoid 1 1.000 - - X1327
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
User_Submission 00.000 Not matched by this tool.
1312.840

Return to query results.
Submit another query.