DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment Alg-2 and gca

DIOPT Version :9

Sequence 1:NP_001104459.2 Gene:Alg-2 / 3355106 FlyBaseID:FBgn0086378 Length:178 Species:Drosophila melanogaster
Sequence 2:NP_001119547.1 Gene:gca / 100125139 XenbaseID:XB-GENE-983090 Length:203 Species:Xenopus tropicalis


Alignment Length:176 Identity:61/176 - (34%)
Similarity:99/176 - (56%) Gaps:11/176 - (6%)


- Green bases have known domain annotations that are detailed below.


  Fly     5 HDGMPDQQFLWDVFQRVDKDRSGHISADELQVALS----NGTWSAFNPETIRLMIGMFDRENKGT 65
            |:|.|    ||..|:.| ..:.|.|.|:|||..|:    .||::.|:.||.|::|.|.||:..|.
 Frog    35 HEGDP----LWGYFRAV-AGQDGEIDAEELQRCLTQAGIQGTYTPFSLETCRVLIAMLDRDFTGK 94

  Fly    66 VSFKDFGALWKYVTDWQNCFRSFDRDNSGNIDKTELKTALTSFGYRLSDHLIDVLLRKFDRFGRG 130
            :.|.:|..:|..::.|:..|.:||:|.||.::..||..|:.:.|||||...:..:::::.:.|| 
 Frog    95 MGFSEFKEVWGALSAWKQNFCTFDQDRSGTVEPHELNQAIFAMGYRLSPPTLSTIVKRYSKNGR- 158

  Fly   131 TILFDDFIQCCIVLYTLTTAFRQHDTDLDGIITIHYEQFLSMVFSL 176
             |.|||::.||:.|..||..||:.|....|.:...|:.||....::
 Frog   159 -IYFDDYVACCVKLRALTDVFRRRDGMQQGFVNFIYDDFLQCTMAI 203

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
Alg-2NP_001104459.2 EF-hand_7 16..71 CDD:290234 21/58 (36%)
EFh 16..71 CDD:238008 21/58 (36%)
EF-hand_7 82..139 CDD:290234 20/56 (36%)
EFh 85..139 CDD:238008 20/53 (38%)
gcaNP_001119547.1 EFh_PEF_grancalcin 39..203 CDD:320061 59/170 (35%)
EF-hand motif 39..67 CDD:320061 12/32 (38%)
EF-hand motif 79..108 CDD:320061 10/28 (36%)
EF-hand motif 109..139 CDD:320061 10/29 (34%)
EF-hand motif 145..172 CDD:320061 8/28 (29%)
EF-hand motif 173..203 CDD:320061 9/29 (31%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 1 1.010 - - QHG54126
OrthoDB 1 1.010 - - D1330600at2759
OrthoFinder 1 1.000 - - FOG0000697
OrthoInspector 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
43.930

Return to query results.
Submit another query.